current user: public

If you have questions about the server, please let us know.

Query: d1vcta1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELast
1 -54.900d1vcta1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors  100  1YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVE 99
2 -36.800d2i0ma_ a.7.12.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}  ali model 3D-neighbors follow..  21  5.ELHELEQSFLGLGQLVLETASKALLALASKDKEMAELIINKDHAINQGQSAIELTCARLQPQVSDLRFVISIMSSCSDLERMGDHMAGIAKAVLQLKE 106
3 -36.600d1xwma_ a.7.12.1 (A:) Phosphate transport system protein PhoU {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  19  5.DLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFIAAQQPVATDLRRIVAAIKIASDIERIADFAVNIAKACIRIGG 106
4 -36.200d4q25a_ a.7.12.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}  ali model 3D-neighbors follow..  21  7.ELEDVRSHLLAMGGLVEKQVNDAVNALIDADSGLAQQVREIDDQINQMERNIDEECVRILPAASDLRLIISISKSVIDLERIGDEASKVARRAIQLCE 108
5 -35.500d1sumb_ a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  24  7.KVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAMEVSPIGKPLLTVTAGIRVAELIENIADKCHDIAKNVLELME 108
6 -6.580d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  16  1............MNSEIELPVQKQLEAYNARDIDAFMAWWADD........................................................ 31
7 -5.990d2idxa_ a.25.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  36..LQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRVAKFLNRLSDYLFTLARYA..... 149
8 -5.910d3grda_ d.17.4.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]}  ali model 3D-neighbors follow..  12  1............MPKANLEIIRSTYEGSASSNAKHLAEALSEK........................................................ 31
9 -5.860d3axja1 a.118.16.0 (A:1-221) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  14  137....DVEDYLLGILQLASELSRFATNSVTMGDYERPLNIS-------HFIGDLNTGFRLLNLKNDGLRKRFDALK--YDVKKIEEVVYDVS........ 214
10 -5.160d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  11  40.......YVLEQLQPLIQENIVNIVDAFYKNHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIG............... 118

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.