current user: public

If you have questions about the server, please let us know.

Query: d1w99a1 f.1.3.1 (A:84-276) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, Cry4Ba [TaxId: 1428]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst TPERVWNDFMTNTGNLIDQTVTAYVRTDANAKMTVVKDYLDQYTTKFNTWKREPNNQSYRTAVITQFNLTSAKLRETAVYFSNLVGYELLLLPIYAQVANFNLLLIRDGLINAQEWSLARSAGDQLYNTMVQYTKEYIAHSITWYNKGLDVLRNKSNGQWITFNDYKREMTIQVLDILALFASYDPRRYPADKLast
1 -78.200d1w99a1 f.1.3.1 (A:84-276) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, Cry4Ba [TaxId: 1428]}  ali model 3D-neighbors  100  1TPERVWNDFMTNTGNLIDQTVTAYVRTDANAKMTVVKDYLDQYTTKFNTWKREPNNQSYRTAVITQFNLTSAKLRETAVYFSNLVGYELLLLPIYAQVANFNLLLIRDGLINAQEWSLARSAGDQLYNTMVQYTKEYIAHSITWYNKGLDVLRNKSNGQWITFNDYKREMTIQVLDILALFASYDPRRYPADK 193
2 -57.800d1ciya3 f.1.3.1 (A:33-255) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]}  ali model 3D-neighbors follow..  28  36FGPSQWDAFLVQIEQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLLA-VQNYQVPLLSVYVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTVLDIVALFSNYDSRRY.... 223
3 -57.700d1dlca3 f.1.3.1 (A:61-289) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId: 1444]}  ali model 3D-neighbors follow..  34  41PSEDPWKAFMEQVEALMDQKIADYAKNKALAELQGLQNNVEDYVSALSSWQKNPVNPHSQGRIRELFSQAESHFRNSMPSF-AISGYEVLFLTTYAQAANTHLFLLKDAQIYGEEWGYEKEDIAEFYKRQLKLTQEYTDHCVKWYNVGLDKLRGSSYESWVNFNRYRREMTLTVLDLIALFPLYDVR...... 229
4 -53.000d1i5pa3 f.1.3.1 (A:1-263) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId: 29339]}  ali model 3D-neighbors follow..  19  85GSTNLMQDILRETEQFLNQRLNTDTLARVNAELIGLQANIREFNQQVDNFLNPTQN-PVPLSITSSVNTMQQLFLNRLPQF-QIQGYQLLLLPLFAQAANMHLSFIRDVILNADEWGISAATLRTYRDYLRNYTRDYSNYCINTYQTAFRGLNTR----LHDMLEFRTYMFLNVFEYVSIWSLFK........ 263
5 -5.760d1eq1a_ a.63.1.1 (A:) Apolipophorin-III {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}  ali model 3D-neighbors follow..  15HAKEFQKTFSEQFNSLVNSKNTQDFNKALKDGSDSVLQQLSAFSSSLQG-DANGKAKEALEQARQNVEKTAEELRKAHPDVEKEANAFKDKLQAAVQTTVQESQKLAKEV---------ASNMEETNKKLAPKIKQAYDDFVKHAEEVQKKLHEAATKQ.................................. 166
6 -5.630d2pbja1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}  ali model 3D-neighbors follow..  26ADDWLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDL-MQHTHIQPWYLRVERAITE......................................................... 160
7 -5.590d3mhra1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14EQAERYEDMAAFMKGAVEKELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLR----DNLTLWT........... 231
8 -5.530d2ps5a_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}  ali model 3D-neighbors follow..  124......HPWWALVNEHFPNVLRHFGPFCSLNLIRSTLDFFEGCWIEQYNFGGFPGSHDYPQFLRRMNGLGHCVGASLWPKEQFNERSLFLEITSAIAQMENWMVWVDDLMSFYKEFDDERDQISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMVAVFSDKDPQVMDTIECFMHGYVT-W-HLCDRRYRLSE 308
9 -5.490d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]}  ali model 3D-neighbors follow..  10  13..WDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEE-QLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEV---------------------------QAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKR...................................... 137
10 -5.420g1avo.1 a.24.8.1 (A:,B:) Proteasome activator reg(alpha) {Human (Homo sapiens) [TaxId: 9606]}  ali 3D-neighbors follow..  4..QPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDINEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVF---ELMTSLHTKLEGFHTQISKYFSERGDAVTKAYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIIL--KNFEKLKKP... 199

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.