current user: public

If you have questions about the server, please let us know.

Query: d1wgsa1 b.34.13.3 (A:8-127) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst EPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKELast
1 -63.200d1wgsa1 b.34.13.3 (A:8-127) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors  100  1EPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKE 120
2 -45.100d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  31  6KIDISENPDKIYFIRREDGTVHRGQVLQSRTTENAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQ...................................... 88
3 -40.000d3m9qa_ b.34.13.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  17  3DETPLFHKGEIVLCYEPDRVLYTSKVLNVFERRNEHGLRYKIHFQGWRPSYDRAVRATVLLKDTEENRQLQRELAEAAK......................................... 88
4 -37.500d5in1a_ b.34.13.0 (A:) automated matches {Rice (Oryza sativa) [TaxId: 4530]}  ali model 3D-neighbors follow..  28  1....SFKEGERVLAYH-GPLLYEAKVQKSE--NKEDEWRYHVHYLGWSKSWDEWVTNDRLLKLTDENIRKQQELEKSQ.......................................... 71
5 -13.400d2xdpa1 b.34.9.0 (A:876-935) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  1..EKVISVGQTVITKHRNTRYYSCRVMAV-----TSQTFYEVMFD--DGSFSRDTFPEDI............................................................ 51
6 -13.100d1g6za1 b.34.13.2 (A:2-69) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}  ali model 3D-neighbors follow..  4.................QEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENL............................................................ 46
7 -11.800d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}  ali model 3D-neighbors follow..  1SERVNYKPGMRVLTKMSGFPWWPSMVVTRKSKPKRAGTFYPVIFFPNKE---LWTGSDSLTPLTSEAISQFLEKPKPKTASLIKAYKMAQSTPDLDS....................... 103
8 -11.400d2l89a_ b.34.9.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}  ali model 3D-neighbors follow..  13  1SADDRLNFGDRILVKAPGYPWWPALLLRRKNTNSSFNVLYKVLFFPDFNF--AWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKTPPDLKEESSTDLE................ 108
9 -11.400d4rxja_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  1....KLHYKQIVWVKLGNYRWWPAEICNPRQGLKHDLGDFPVFFFGSHDY--YWVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIE............ 108
10 -11.200d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  10  4QDDKEFGIGDLVWGKIKGFSWWPAMVVSWKAKRQAMPGMRWVQWFGDGK---SEISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKP...... 117
11 -11.100d2xdpa2 b.34.9.0 (A:936-994) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  1....PPAEGEVVQVKWPDGKLYGAKYFGSNIAH-----MYQVEFEDGSQIA---MKREDIYTLDEE...................................................... 54
12 -10.900d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  3....QWKVGDKCSAIWSDGCIYPATIASIDFKRE----TCVVVYTGYGNR--EEQNLSDLLSPICE...................................................... 59
13 -10.400d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  29  1.................DLVYAAEKIIQKRVKK--GVVEYRVKWKGWNQRYNTWEPEVNI............................................................ 41
14 -10.400d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  28PPLNNFKVGMKLEAIDKKNLICPATIGDV-------GDEVHITFDGWSGAFDYWCKYDS............................................................. 82
15 -10.400d3s6wa_ b.34.9.1 (A:) Tudor domain-containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  3......KPGDECFALYWDNKFYRAEVEALHSSGM----TAVVKFIDYGNY--EEVLLSNIK........................................................... 52
16 -10.300d3svma_ b.34.13.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1.................EDVFEVEKILDMKTE--GGKVLYKVRWKGYTSDDDTWEPEIHL............................................................ 41
17 -10.200d5afwa1 b.34.13.2 (A:270-362) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  38............................FEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKR..................................... 92
18 -10.100d2l8da1 b.34.9.1 (A:5-66) Lamin-b receptor {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  18  2.PNRKYADGEVVMGRWPGSLYYEVQVTSYDDASH----LYTVKYKDGTE---LALKESDIRLQSSFKQ.................................................... 62
19 -10.100d3qbya_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  2..PHAFKPGDLVFAKMKGYPHWPARIDDIDGAVKPPPNKYPIFFFGTHE---AFLGPKDLFPYDKCKDKYGKPNKRK........................................... 75
20 -10.000d2m2la1 b.34.13.0 (A:8-67) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}  ali model 3D-neighbors follow..  3.................PQTFEVERIVRKKIVH--GNTSYLVKWKNYSSKDNTWETEDDI............................................................ 43
21 -9.980d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  21EGSYAPRRGEFCIAKFVDGEWYRARVEKVESPA-----KIHVFYIDYGNR--EVLPSTRLGTLSPA...................................................... 79
22 -9.820d3mtsa1 b.34.13.0 (A:44-104) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  4........................YLCDYKKIR--EQEYYLVKWRGYPDSESTWEPRQNL............................................................ 37
23 -9.800d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  34...............................NNCKENYEFLIKWTDESHLHNTWETYESI............................................................ 62
24 -9.690d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  30HNKNGFKLGMKLEGIDPQHMYFILTVAEVC------GYRLRLHFDGYSECHDFWVNANS............................................................. 84
25 -9.530d4quca_ b.34.13.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  20  6........................KILGKRFVN--GRPQVLVKWSGFPNENNTWEPLENV............................................................ 39
26 -9.510d5e4xa_ b.34.13.2 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  23  6........................SVIGKRVGDDGKTIEYLVKWTDMSD--ATWEPQDNV............................................................ 39
27 -9.200d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  27PPPLGFQVGMKLEAVDRMNLVCVASVTDV-------DSRFLVHFDNWDDTYDYWCDPSS............................................................. 81
28 -9.140d1wjra1 b.34.9.3 (A:8-121) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1.PIDLITVGSLIELQDSQNQYWIVSVIENV------GGRLRLRYVGLEDTYDQWLFYLD............................................................. 56

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.