current user: public

If you have questions about the server, please let us know.

Query: d1wvta_ a.25.2.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst KDSEIVKALGDLDELNSVLGVVSSLYPELSEVIQKLQNDIFSISSEIAGFDMNFSDEKVKGIEELITNYSKELEPLRNFVLPGGHIASSFLHLARAVCRRAERSVVTLLKESKAKEVHAKYLNRLSSLLFVLALVVNKRTNNPNVIWRLast
1 -85.400d1wvta_ a.25.2.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}  ali model 3D-neighbors  100  1KDSEIVKALGDLDELNSVLGVVSSLYPELSEVIQKLQNDIFSISSEIAGFDMNFSDEKVKGIEELITNYSKELEPLRNFVLPGGHIASSFLHLARAVCRRAERSVVTLLKESKAKEVHAKYLNRLSSLLFVLALVVNKRTNNPNVIWR 148
2 -78.900d2idxa_ a.25.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  37  1.DDQVFEAVGTTDELSSAIGFALELVHTFAEELQKIQCTLQDVGSALATPCSSFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYM 161
3 -78.200d1noga_ a.25.2.2 (A:) Hypothetical protein Ta0546 {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  35  1..SPVVEVQGTIDELNSFIGYALVLSDDIRNDLFRIQNDLFVLGEDVSTGGRTVTREMIDYLEARVKEMKAEIGKIELFVVPGGSVESASLHMARAVSRRLERRIVAASKLTEINKNVLIYANRLSSILFMHALISNKRLNIPEKIW. 149
4 -76.300d3ci3a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]}  ali model 3D-neighbors follow..  33  22KNDPRVAAYGEVDELNSWVGYTKSLIQVLSNELEEIQQLLFDCGHDLATPADDKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYR 180
5 -73.500d2g2da_ a.25.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  32  1.TDARLVAYADCDEANAAIGAALALGTQITDVLRQIQNDLFDAGADLSTPILRIAQSYIDRLEGWCDAYNAGLPALKSFVLPGGSPLSALLHVARTVVRRAERSAWAAVDAEGVSVLPAKYLNRLSDLLFILSRVANPDGDVLWRPG. 159
6 -8.370d1niga_ a.25.2.1 (A:) Hypothetical protein Ta1238 {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  15  17.DHVYFKFRSEIEAAEAYLGLAISEGIKVRE-TREILDIIDTVYNSLSDPESKLNDFQEKRLNFTEEDWYDIKEKANN-----GNRWSLYMFLARSAVDSAVYWSYRMKETEEVKEEMISKLLKAGYVIL.................. 143
7 -7.050d1z0pa1 a.2.18.1 (A:1-77) Hypothetical protein SPy1572 {Streptococcus pyogenes [TaxId: 1314]}  ali model 3D-neighbors follow..  17  24................................................................................................LAMATSQEVAQEDGDERAKDAFIRYESKLDAYEFLLGKFDNYKNGKA..... 70
8 -6.500d3zxfa_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  9................................................................................LPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNRLDTSEVVFNSKEQGSWGREE.... 73
9 -6.190d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}  ali model 3D-neighbors follow..  12  1.................................SEITIGVLSLQGDFEPHINHFIKLQIPSLNIIQVRNVHDLGLCDGLVIPGGESTTVRRCCAYENDTLYNALVHFIHVLKKPIWGTCAGCILLSK..................... 94
10 -6.100d1t3ta3 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  16  5..............LRGSPALSAFRINKLLARFQAANLQVHNIYAEFADLNAPLNDSEQAQLTRLLQYGPALVTPRPGTISPWSSKATDIAHNC-QQVDRLERGVAYYIEASTLTAEQWRQVDRMMETVF.................. 140

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.