current user: public

If you have questions about the server, please let us know.

Query: d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst HEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRLLast
1 -66.100d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors  100  1HEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRL 149
2 -59.600d2zs0c_ a.1.1.0 (C:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  34  1.SSCCSSEDRANVMHNWDAAWSAA-YSDRRVALAQAVFASLFSRDAAAQGLFSGVSADNPDSADFRAHCVRVVNGLDVAINMLNDPAVLNEQLAHLSAQHQARAGVAAAHFDVMAEAFAEVMPQVSSCFSSDSWNRCFARIANGISAGL 147
3 -59.400d3wctd_ a.1.1.0 (D:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}  ali model 3D-neighbors follow..  35  2....CSEADATIVIKQWNQIYNAGIGAKSRWTMGNEIFSSLFKLKPESEVLFNNVNVANMSSGAFHAHTVRVLSGLDMGINYLNDAGTLTSLTAHLAAQHVARTGLKAVYFDAMGKVLMTVLPSLIDNFNPDAWRNCLLPLKNAIAKGL 146
4 -59.100d2zs0d_ a.1.1.0 (D:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  25  1..ECCSRGDAEVVISEWDQVFNAAMAGSSESAIGVAIFDVFFTSSGVSPSMFPGGGD--SSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAISGVTGAAVTHLSEAISSVVAQVLPSAHIDAWGYCMAYIAAGIGAGL 145
5 -56.100d2zs0a_ a.1.1.0 (A:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  28  2....CNRLEQILVKTQWAQSYGEAE---NRAAFSRDLFSELFNIQGSSRALFSGVGVDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHAS-RNLDASNFAAMGQAVMSVVPTHLDCFNQHAWGECYERIASGISG.. 140
6 -53.600d2dc3a_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1..EELSEAERKAVQAMWARLYANCE------DVGVAILVRFFVNFPSAKQYFSQFKLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAPETQRAWAKLRGLIYSHVTAAY 150
7 -53.400d2zs0b_ a.1.1.0 (B:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  29  2....CTSLNRLLVKRQWAEAYGEGTNR---ELLGNRIWEDLFANMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDS-RGIPAAGYPAFVASAISAVRATVGARDNDAWNSCMNQIVSGISG.. 142
8 -52.400d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  31  2....CLVTESLKVKLQWASAFGHAHER---VAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVE-RNLKPEFFDIFLKHLLHVLGDRLGTHDFGAWHDCVDQIIDGIK... 140
9 -50.800d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}  ali model 3D-neighbors follow..  18  2....LSAAEADLAGKSWAPVFANKN------ANGLDFLVALFEKFPDSANFFADFKADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHV-GFGVGSAQFENVRSMFPGFVASVAAAGADAAWTKLFGLIIDALKAA. 144
10 -50.300d3pt8a_ a.1.1.0 (A:) automated matches {Clam (Lucina pectinata) [TaxId: 244486]}  ali model 3D-neighbors follow..  17  3....LTNPQKAAIRSSWSKFMDNGV------SNGQGFYMDLFKAHPETLTPFKSLLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHN-NRGIRASDLRTAYDILIHYMEDHMVGGAKDAWEVFVGFICKTLGDYM 147
11 -50.300d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 244486]}  ali model 3D-neighbors follow..  16  1...SLSAAQKDNVKSSWAKASAAWG------TAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKA-RGISAGQLEAAFKVLAGFMKSYGGDE--GAWTAVAGALMGMIRPDM 142
12 -49.900d1x3ka_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}  ali model 3D-neighbors follow..  15  5....LSDSEEKLVRDAWAPIHGDLQ------GTANTVFYNYLKKYPSNQDKFETLKDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHV-ARPITHGSYNDLRGVIYDSMH--LDSTHGAAWNKMMDNFFYVFYECL 144
13 -49.800d3g46a_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}  ali model 3D-neighbors follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
14 -49.700d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  17  11....LTDGDKKAINKIWPKIYKEYE------QYSLNILLRFLKCFPQAQASFPKFSSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTIDGGA------EFEKLFSIICILLRSA. 145
15 -49.400d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  20  1......RPESELIRQSWRVVSRSPL------EHGTVLFARLFALEPSLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHR-AVGVRLSSFSTVGESLLYMLEKSLGPATRTAWSRLYGAVVQAMSRGW 146
16 -49.000d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  19  12....LTLAQKKIVRKTWHQLMRNKT------SFVTDVFIRIFAYDPSAQNKFPQMASQLRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDL-NKVGADHYNLFAKVLMEALQAELGEKTRDAWAKAFSVVQAVLLVKH 156
17 -48.600d3qqqa_ a.1.1.2 (A:) automated matches {Trema tomentosa [TaxId: 3480]}  ali model 3D-neighbors follow..  18  2....FTEEQEALVVKSWAVMKKNSA------ELGLKFFLKIFEIAPSAKNLFSYLKDPLEQNPKLKPHAMTVFVMTCESAVQLRKAGVRESNLKRLGAIHFK-NGVVNEHFEVTRFALLETIKEAVPPEMKNAWGEAYDQLVAAIKSEM 149
18 -48.500d2bk9a_ a.1.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  22  1....MNSDEVQLIKKTWEIPVATPT------DSGAAILTQFFNRFPSNLEKFPFRDEELSGNARFRAHAGRIIRVFDESIQVLGDLEKLDEIWTKIAVSHI-PRTVSKESYNQLKGVILDVLTASLDESQAATWAKLVDHVYAIIFKAI 146
19 -48.500d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  17  2....LSAAQRQVVASTWKDIAG----ADNGAGVGKECLSKFISAHPEMAAVFGFSGAS---DPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGNKHIKAEYFEPLGASLLSAMEHRIGAAAKDAWAAAYGDISGALISGL 145
20 -48.200d4hswa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  15  2............FKQDIATIRGDLR------TYAQDIFLAFLNKYPDERRYFKNYVQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHS-SLTTGNFEKFFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAG 135
21 -48.100d2c0ka_ a.1.1.0 (A:) automated matches {Gasterophilus intestinalis [TaxId: 84525]}  ali model 3D-neighbors follow..  15  1....MNSEEVNDIKRTWEVVAAKMT------EAGVEMLKRYFKKYPHNLNHFPWFKDDLPENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHH-EKKVERRSYNELKDIIIEVVCSCVKEKQVHAYHKFFDRAYDIAFAEM 147
22 -47.900d1naza_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}  ali model 3D-neighbors follow..  18  3....LSEGEWQLVLHVWAKVEADVA------GHGQDIYIRLFKSHPETLEKFDRFKAEMKASEDLKKQGVRVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPADAQGAMNKALELFRKDIAAKY 147
23 -47.900d2wtga_ a.1.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  16  1..SMNRQEISDLCVKSLEGRM--VGTEAQNIENGNAFYRYFFTNFPDLRVYFKGAEDDVKKSERFDKQGQRILLACHLLANVYTNEEVFKGYVRETINRHRIY-KMDPALWMAFFTVFTGYLESVLNDQQKAAWMALGKEFNAESQTHL 150
24 -47.800d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  23  2....FTACEKQTIGKIAQVLAKSPE------AYGAECLARLFVTHPGSKSYFEYKD-YSAAGAKVQVHGGKVIRAVVKAAEHVDD---LHSHLETLALTHGKKLLVDPQNFPMLSECIIVTLATHLTEDTHCAVDKLLSAICQELSSRY 139
25 -47.300d1x46a_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}  ali model 3D-neighbors follow..  22  7....MEAGDIALVKSSWAQIHDK----------EVDILYNFFKSYPASQAKFSAFAESLKDTAPFALHATRIVSVINEAIALMENRPALKNVLKQQGINHKG-RGVTAAHFEEFETALEAFLESGYNAGTKKAWDSAFNNMYSVVFPEL 150
26 -46.000d3ozua1 a.1.1.0 (A:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]}  ali model 3D-neighbors follow..  17  2....LTQKTKDIVKATAPVLAEHGY------DIIKCFYQRMFEAHPELKNVFNM------AHQEQGQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHAS-LGVKPEQYPIVGEHLLAAIKEVLGDDIISAWAQAYGNLADVLMGM. 136
27 -46.000d2w72a_ a.1.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2....LSPADKTNVKAAWGKVGAHAG------EYGAEAYERMFLSFPTTKTYFPHFD-LSHGSAQVKGQGKKVADALTNAVAHVDDMPNA---LSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPPAVHASLDKFLASVSTVLTSKY 140
28 -46.000d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  11  1...TLTKHEQDILLKELGPHVDTPAHI---VETGLGAYHALFTAHPQYISHFSRLEENVMQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSR-KVTKDEFMSGEPIFTKYFQNLVKDAVEKFLKHVFPMMAAEI.... 147
29 -45.700d1ecaa_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  20  1....LSADQISTVQASFDKVKGD----------PVGILYAVFKADPSIMAKFTQFAESIKGTAPFETHANRIVGFFSKIIGELPN---IEADVNTFVASHKPR-GVTHDQLNNFRAGFVSYMKAHTDAGAEAAWGATLDTFFGMIFSKM 136
30 -45.500d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  16  1.....ANKTRELCMKSLEHAK--VDTSNEARQDGIDLYKHMFENYPPLRKYFKSREEDVQNDPFFAKQGQKILLACHVLCATYDDRETFNAYTRELLDRHARDVHMPPEVWTDFWKLFEEYLGKTLDEPTKQAWHEIGREFAKEINK.. 147
31 -45.500d3qm9a_ a.1.1.2 (A:) automated matches {Thunnus atlanticus [TaxId: 48168]}  ali model 3D-neighbors follow..  23  1.......ADFDAVLKCWGPVEADYT------TIGGLVLTRLFKEHPETQKLFPKFAADIAGNAAVSAHGATVLKKLGELLKAKGS---HAAILKPLANSHATKHKIPINNFKLISEVLVKVMQEKAGAGGQTALRNVMGIIIADLEANY 139
32 -45.300d3wfwa1 a.1.1.0 (A:1-133) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}  ali model 3D-neighbors follow..  19  1....MTREEIKMIQKSWLRVIDKMD------EAGLLFYRRLFDVEPKVRPLF---------KIDIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVK-YGVKAEHYPVVGHTLIWTLRKMIGSQLEQLWTQAYEALAQVMIEE. 132
33 -45.200d3d1kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  15  3....WTDKERSIISDIFSHMDYD--------DIGPKALSRCLVVYPWTQRYFSGFAEGIMSNANVAAHGIKVLHGLDRGMKNMDN---IADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGAETQGAFQKFLAAVVSALGKQY 145
34 -45.200d2wy4a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  18  1.....TKEQIQIIKDCVPILQKNGE------DLTNEFYKIMFNDYPEVKPMFNM------EKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVN-LGVKEEHYPIVGACLLKAIKNLLNEATLKAWEVAYGKIAKFYIDI. 132
35 -45.100d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}  ali model 3D-neighbors follow..  13  2....LTAAQIKAIQDHWFLNIKG-----CLQAAADSIFFKYLTAYPGDLAFFHKFSYGLRSNPAYKAQTLTVINYLDKVVDALGGN--AGALMKAKVPSHDAM-GITPKHFGQLLKLVGGVFQEEFSPTTVAAWGDAAGVLVAAMK... 141
36 -45.000d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  18  3....LSEDQEHYIKGVWKDVDHK--------QITAKALERVFVVYPWTTRLFSKLQGFSANDIGVQQHADKVQRALGEAIDDLKK---VEINFQNLSGKHQE-IGVDTQNFKLLGQTFMVELALHYKPKEHAAAYKFFRLVAEALSSNY 140
37 -45.000d3ubca_ a.1.1.0 (A:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}  ali model 3D-neighbors follow..  18  1....IDQKEKELIKESWKRIEPNKN------EIGLLFYANLFKEEPTVSVLF---------QNPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQ-YGVVDSHYPLVGDCLLKSIQEYLGEEAKAAWTKVYGIAAQVMTA.. 131
38 -44.300d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  16  3....WTQEERDEISKTFQGTDMK--------TVVTQALDRMFKVYPWTNRYFQKRT-----DFRSSIHAGIVVGALQDAVKHMDD---VKTLFKDLSKKHADDLHVDPGSFHLLTDCIIVELAYLRKPHIQGIWDKFFEVVIDAISKQ. 134
39 -36.300d2xkia_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  18  2..............VNWAAV-------------VDDFYQELFKAHPEYQNKFGFKGGSLKGNAAYKTQAGKTVDYINAAIGGSAD-------AAGLASRHKG-RNVGSAEFHNAKACLAKACSAHGAPDLGHAIDDILSHL........ 110
40 -34.600d1tu9a1 a.1.1.2 (A:2-130) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  10  1.......NAADRVMQSYGRCCASTG-------FFDDFYRHFLASSPQIRAKFA--------TTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGASHSRAA-LDIRPELYDLWLDALLMAVAEHCDAETRDAWRDVMGRGIAVIKSY. 128
41 -10.900d2ig3a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  10  1...................MKFETINQESIAKLMEIFYEKV-RKDKDLGPIFNNAIGT--SDEEWKEHKAKIGNFWAGMLLGEGDYN-------QPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNML 121
42 -9.020d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  34....LGDAELYVLEQLQPLIQENIV------NIVDAFYKNL-DHESSLMDIINDHSSVDRLKQTLKRHIQEMFAG-----------DEFIEKRNRIASIHL-RIGLLPKWYMGAFQELLLSMIDIYEASITNQ-LKAIKATTKILNLEQ 164

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.