current user: public
If you have questions about the server, please let us know.

Query: d1yiba1 a.245.1.1 (A:190-250) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
# Score Template Links and tools%idFirst DDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDLast
1 -42.400d1yiba1 a.245.1.1 (A:190-250) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1DDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATD 61
2 -5.610d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  1.KRFSSFQAAQIRIARPTGQLDEIIRFYEEGL............................. 31
3 -4.200d2p7oa_ d.32.1.2 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}  ali model 3D-neighbors follow..  23  1......MISGLSHITLIVKDLNKTTAFLQNIF............................. 26
4 -4.140d1ug3a2 a.118.1.14 (A:1438-1564) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  58ETPLRVDVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLE-QPPNLLRMFFDALYDED 117
5 -4.070d3chma1 a.118.8.9 (A:4-87) COP9 signalosome complex subunit 7 (CSN7), N-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  15  25..............PLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGT. 70
6 -4.040d1t92a1 d.24.1.3 (A:26-132) Pullulanase secretion protein PulG {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  6  5KADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAE................ 49
7 -3.950d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  36  24..................QTLELEKEFLFNMYRRYEV........................ 46
8 -3.800d1s64b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  6DRHVRFFQRCLQVLPERYSSLETSR-IAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLP. 66
9 -3.780d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  34  1......MLTGLNHLTLAVADLPASIAFYRDLL............................. 26
10 -3.630d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  34  2.........RLLHTMLRVGDLQRSIDFYTKVL............................. 24
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.