current user: public

If you have questions about the server, please let us know.

Query: d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MLKKGMTTVLDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFHGLDVKFHTQAFSAHGSGREVIDAMCHATLTYRMLEPTRVVNWEVIIMDEAHFLDPASIAARGWAAHRARANESATILMTATPPLast
1 -75.600d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors  100  1MLKKGMTTVLDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFHGLDVKFHTQAFSAHGSGREVIDAMCHATLTYRMLEPTRVVNWEVIIMDEAHFLDPASIAARGWAAHRARANESATILMTATPP 138
2 -52.200d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  59  6MLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKKRLRTVILAPTRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLNIMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPP 143
3 -45.300d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  19  4VPQSFQVAHLHAPTGSGKSTKVPAAYA----AQGYKVLVLNPSVAATLGFGAYMSKAGVDPNIRTGVRTITTGSPITYSTYGKFLAD--GGCSGGAYDIIICDECHSTDATSILGIGTVLDQAEAGARLVVLATATP. 136
4 -36.600d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  21  105LYQNNQIMVFVGETGSGKTTQIPQFVLFDEMLENTQVACTQPRRVAAMSVAQRVAGEEVGYSIR-FENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVRRPDLKIIIMSAT.. 249
5 -27.200d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  17  82.WLVDKRGCIVLPTGSGKTHVAMAAIN----ELSTPTLIVVPTLALAEQWKERLGIF-GEEYVGEFSGRIKELKPLTVSTYDSAYVN--AEKLGNRFMLLIFDEVHHLPAES-----YVQIAQMSIAPFRLGLTATF. 205
6 -26.700d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  11  127...VNRRRILNLPTSAGRSLIQALLARYYLENYEGKILIIVPTTALTTQMADDFVDY------ASKDDKYKNDAPVVVGTWQTVVKQPKE---FSQFGMMMNDECHLATGKSISSIISGLNNCMF----KFGLSGSL. 262
7 -26.200d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  19  26.......CLIVLPTGLGKTLIAMMIAEYRLTKYGGKVLMLAPTKPLVLQHAESFRRL-TGEKSPEERSKAWARAKVIVATPQTIENDLLAGRSLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTASP. 166
8 -23.300d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  49RILRKESFAATAPTGVGKTSFGLAMSLFL-ALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTEFMQNLRNFKIVITTTQFLSKHYRE---LGHFDFIFVDDVDAILKASKNVDKLLHLLGFHYDLKLMVSTATAK 210
9 -23.200d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  19  107.......RLLQGDVGSGKTVVAQLAILD-NYEAGFQTAFMVPTSILAIQHYRRTVATTPSEKEKIKSGLRNGQIDVVIGTHALIQEDV----HFKNLGLVIIDEQH-----RFGVKQREALMNKGKMVDTLVMSATPP 243
10 -21.600d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  18  37.VFSGKNLLLAMPTAAGKT-LLAEMAMVREAIKGGKSLYVVPLRALAGEKYESFKKEKIGLRIGISTGDYEGDCDIIVTTSEKADSLIRNRASIKAVSCLVVDEIHLLDSEKTLEILVTKMRRMNKALRVIGLSATAP 183
11 -21.600d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  80........LVCGDVGFGKTEVAM-RAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIFRSAKEQTQILAEVAEGKI-KLLQSDVKFKDLGLLIVDEEH-----RFGVRHKERIKAMRANVDILTLTATP. 213
12 -20.100d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  60VMLHGRELLASAPTGSGKTLAFSIPILMQLKQKGFRALIISPTRELASQIHRELIKISEGTGFRIFGPKSSKKFDILVTTPNRLIYLLKQDPDLASVEWLVVDESDKLFEDGKT-LASIFLACTSHKVRRAMFSATFA 219
13 -19.500d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  43PIIEGHDVLAQAQSGTGKTGTFSIAALQRI-VKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHDAEGLRDAQIVVGTPGRVFDNIQRRRRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMP 193
14 -19.200d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  15  37LHNPPRNMIAQSQSGTGKTAAFSLTMLTRV-DASPQAICLAPSRELARQTLEVVQEMGKFTKITSQEKNKQINAQVIVGTPGTVLDLMRRKLQLQKIKIFVLDEADNMDQQGLGDQCIRVKRFLPKDTQLVLFSATFA 185
15 -18.700d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  56LALQGKDVLGAAKTGSGKTLAFLVPVLEALYRDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGEAERINNINILVCTPGRLLQHMDETVHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQT 211
16 -18.700d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  47LALQGRDIIGLAETGSGKTGAFALPILNALLETPQFALVLTPTRELAFQISEQFEALGSSIGVQSASLALAKKPHIIIATPGRLIDHLENTKNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMT 199
17 -18.600d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  16  34GALRGESMVGQSQTGTGKTHAYLLPIMEKIKPERAQAVITAPTRELATQIYHETLKIT-GTDKQKALEKLNVQPHIVIGTPGRINDFIREQADVHTAHILVVDEADLMLDMGFITDVDQIAARMPKDLQMLVFSATIP 189
18 -18.600d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  35IALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDQAMVIVPTRELALQVSQICIQVS-GTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFP 187
19 -18.500d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  19  27LMLQGKNVVVRAKTGSGKTAAYAIPILELGM----KSLVVTPTRELTRQVASHIRDIGRYMDTKVAQINRVRNADIVVATPGRLLDLWSKGVDLSSFEIVIIDEADLMFEMGFIDDIKIILAQTSNRKITGLFSATIP 171
20 -18.500d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  34LGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLQILILAPTREIAVQIHSVITAIGIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLASKQMLAVSATYP 186
21 -18.400d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  22  34LALEGKDLIGQARTGTGKTLAFALPIAERLAPSQERALVLTPTRELALQVASELTAVAPHLKVVAVYGGTGYGKQKEALLRGALDYLRQGVLDLSRVEVAVLDEADEMLSMGFEEEVEALLSATPPSRQTLLFSATLP 186
22 -17.600d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  52IILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQGPGMLVLTPTRELALHVEAECSKYS-GRNRNGQIEDISKGVDIIIATPGRLNDLQMNNVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWP 208
23 -17.100d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  34QAILGMDVLCQAKSGMGKTAVFVLATLQQL-TGQVSVLVMCHTRELAFQISKEYERFSKYMP-KDEEVLKKNCPHIVVGTPGRILALARNKSNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTHEKQVMMFSATLS 188
24 -16.800d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  46IIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDYPISLVLAPTRELAVQIYEEARKFSYRSRVRPC-RDLERGCHLLVATPGRLVDMMERGIGLDFCKYLVLDEADRMLDMGFQIRRIVEQMPPKGVRHTMMFSATFP 219
25 -16.800d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  46TILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQGPYGLIICPSRELARQTHGILEYYC-GMSVKEQMETIRHGVHMMVATPGRLMDLLQKKVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMP 211
26 -15.900d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebrafish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  15  77..ENSYGCIMADEMGLGKTLQCI-TLIWTLLKQSDKVIVVSPSSLVYNEVGKWLGGRVQPVAIDGGSKDEIDSKLILIISYETF-RLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRR---VLISGTP. 230
27 -15.600d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  37.VLSGRDCLVVMPTGGGKSLCYIPALLLNGL-----TVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRALGQLRQRFPTLPFMALTAT.. 183
28 -15.500d2gk6a1 c.37.1.19 (A:295-324,A:416-702) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  100...QRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVLKRTAERELLMNADVICCTCVGAGDPRLAKM---QFRSILIDESQATEPECMVPVVLGAK-------QLILVGQLGP 284
29 -14.800d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  20  35........CLADDMGLGKTLQTIAVFSAKKENELTPSLVICPLSVLEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRDT--RLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYR---IALTGTP. 162
30 -14.600d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  162...TRRISVISGGPGTGKTTKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPL-------TDEQKKRIPEDASTLHRLLGAQPGSQLDVLVVDEASMIDLPMMSRL-----DALPDHARVIFLG.... 295
31 -13.000d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}  ali model 3D-neighbors follow..  13  23.LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVT--EETPQDIIKNARSFGWKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSASSVVRRELFRLVARLKQIGATTVMTTERI. 172
32 -12.800d1cr1a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  12  32.ARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM--EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFLLAKLAYMRSGLGCDVIILDGESDERKMIDNLMTKLKGFAKSTGVVLVVIC.... 194
33 -12.800d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}  ali model 3D-neighbors follow..  10  23.FFKDSIILATGATGTGKTL-LVSRFVENACANKERAILFA-----YEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAY-EDHLQIIKSEINDFKPARIAIDSLSASNNAFRQFVIGVTGYAKQEEITGLFTNTSD. 162
34 -12.800d1nksa_ c.37.1.1 (A:) Adenylate kinase {Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  10  2.....KIGIVTGIPGVGKST-VLAKVKEILDNQGINNKIINYGDFMLATALKL--------YAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADP 126
35 -12.800d1w4ra1 c.37.1.24 (A:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1...RGQIQVILGPMFSGKSTELM-RRVRRFQIAQYKCLVIKYA-------------KDTRYSSSFCTHDRNTMEALPACLLRDVAQEA------LGVAVIGIDEGQFFP............................. 86
36 -12.500d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  10  3.....KIILTIGCPGSGKST-----WAREFIAKNPGFYNIN-----RDDYRQSIMAHE---ERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKG---VIISDTNLNPER----RLAWETFAKEYGWKVEHKVFDVP 115
37 -12.500d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  2.....RHVFLTGPPGVGKTT-LIHKASEVLKSSGVPV-VRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPV.. 145
38 -12.200d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  14  3.......IIITGEPGVGKTTLVIVERLGKRAIGFWTEEVRDPETKKRTGFRIITTEGKKKIFSSKFFTSKKLVGSYGVNVQYFILERAYREAKKDRRKVIIIDEIGKMELFSKKFRDLVRQIMHDPNVNVVATIPI.. 139
39 -11.700d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  14  1..ERGIIIVFTGN-GKGKTTAAFGTAA-RAVGHGKNVGVVQ-TWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVW-QHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARHQTVIITGRGCH 138
40 -11.500d1khta_ c.37.1.1 (A:) Adenylate kinase {Methanococcus voltae [TaxId: 2188]}  ali model 3D-neighbors follow..  11  1....NKVVVVTGVPGVGSTT-SSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEE----------NLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTG 123
41 -11.200d2vhja_ c.37.1.11 (A:) automated matches {Pseudomonas phage [TaxId: 161736]}  ali model 3D-neighbors follow..  11  122...ASGMVIVTGKGNSGKT--PLVHALGEALGGKDKYATVR-----FGEPLSGYNTDFNVFVDDIAR-------------------------AMLQHRVIVIDSSGGISRGAFDLLSDIGAMAASRGCVVIASL.... 233
42 -11.200d3jb9x3 c.37.1.19 (X:385-460,X:619-1044) Pre-mRNA splicing factor Cwf11 / Aquarius {Schizosaccharomyces pombe 972h- [TaxId: 284812]}  ali model 3D-neighbors follow..  15  199...QPGLTMVNGPTRCGKHVLVC-KLLEVLQDTNDRTVVLSDSNFSMNTLFTLLEK.................................................................................. 252
43 -11.100d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  20.IETGSITEMFGEFRTGKTQICHTLAVTCQLPIEGKAMYIDTEGTFRPERLLAVAER-YGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDELSARQMHLARFLRMLLRLADEFGVAVVITNQV.. 172
44 -10.900d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}  ali model 3D-neighbors follow..  18  8..KDRNLWFLVGLQGSGKTTTAAK--LALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESP-------ESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELLKEVLGPDEVLLVLDAMT.. 134
45 -10.900d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  12  4......LIVMVGLPARGKTY------ISKKLTRYLNFIGVPTREFNVGQYRRDMVKT--YKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATNTTRER----RAMIFNFGEQNGYKTFFVESI.. 121
46 -10.800d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  15  53.....RAAMLYGPPGIGKTT-------------------------AAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILIC.... 161
47 -10.700d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  26.MVAGTVGALVSPGGAGKSMLALQLAAQIAGGPTGPVIYLPPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLENASGPMAQVIGRMEAIAADTGCSIVFLHHA.. 179
48 -10.500d4pj3a3 c.37.1.19 (A:416-492,A:662-1133) Pre-mRNA splicing factor Cwf11 / Aquarius {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  232...QPGLTMVVGPPGTGKTDVAV-QIISNIYHNEQRTLIVTHSNQALNQLFEKIMALDISGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAQILEIETFIPLLLQNPQDGFSRLKRWIMIGDPP 519
49 -10.500d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  16  39YVKTGSMLLFAGPPGVGKTTAA---------------------LALARELFGE------NWRHNFLELNASDERGINVIREKVKEFARTKPIGGASFKIIFLDEADALTQDAQQALRRTMEMFSSNVRFILSCNYS.. 149
50 -10.400d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}  ali model 3D-neighbors follow..  14  1.MPTLLRVYIDGPHGMGKTTTT--QLLVALGSRDDIVYVPEPRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGTLIFDRHPIAALLCYPAARYLMGSMTPQAVLIVLGALPED 166
51 -10.300d1ihua2 c.37.1.10 (A:308-583) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  19...EHGLIMLMGKGGVGKTT-MAAAIAVRLADMGFDVHLTTDPHEETERYRQHVLETKGKELDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIREAGKRFVVMD................................... 140
52 -10.300d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  4LQNIPPYLFFTGKGGVGKTSISCATAIRLA-EQGKRVLLVSPASNVGQVFSQTIGNTIQAIAVSSINEQLSGACTTEIAAFDEFTGLLTDASLLTRFDHIIFD................................... 142
53 -10.200d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  36.......LLLYGPNGTGKKTRCMALLESIFGPGVYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSM.. 171
54 -10.000d2nq2c_ c.37.1.0 (C:) automated matches {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  27.LNKGDILAVLGQNGCGKSTLLIHRPIQGKIEVYQSIGFVPQFFSSPFAYSKSHDYQVAMQALDYLNLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDESALDLANQDIVLSLLIDLAQSQNMTVVFTT.... 185
55 -9.850d2d2ea_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  15  25.VPKGEVHALMGPNGAGKSTLGYTVERGEILLDGENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLARYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSLDIDALKVVARGVNAMRGPNFGALVIT.... 199
56 -9.770d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  12  2......LIAIEGVDGAGKRTLV--EKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQ--GLCRGYDVVILDR.................................. 95
57 -9.750d1sgwa1 c.37.1.12 (A:2-200) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  13  23.IEKGNVVNFHGPNGIGKTTLL-IIYNGVPITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEKKKLGELSQGTIRRVQLASTLLVNAEIYVLDD---IDEDSKHKVLKSILEILKEKGIVIISS.... 181
58 -9.720d4hzia_ c.37.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 267671]}  ali model 3D-neighbors follow..  15  26.IKTNEHCVLLGRNGAGKST-LVNLIYGMIWATSGTIRLFQETEIAIQDLRKRIGILDSSQQENSIQRKLTVKDTILTLSSGEKKKILFLRSIVNEPDFLIMDESSLDLTAREDFLGFLKEYHSKKKFTSLYIT.... 200
59 -9.510d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}  ali model 3D-neighbors follow..  17  2...TTRMIILNGGSSAGKSG--IVRCLQSVLPE......................................................................................................... 29
60 -9.510d2yhsa2 c.37.1.10 (A:285-495) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  15  7..KAPFVILMVGVNGVGKTTTI----LARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADS-------ASVIFDAIQAAKARNIDVLIADKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDAS.. 138
61 -9.440d2aota_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  46..TKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCNNEVVEPSAEQIAKYKELVAKTSNLENVKF---------AWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVS... 170
62 -9.440d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  42..LDSFFLFLHGRAGSGKSV-----IASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEE---------TIRWAQELRLRCLVTTRD.. 166
63 -9.440d1yj5a2 c.37.1.1 (A:351-522) 5` polynucleotide kinase-3` phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  14  12..PNPEVVVAVGFPGAGKST-----FIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAA------------------------------------LRQGKRVVIDNTNPDVPS----RARYIQCAKDAGVPCRCFNFCAT 102
64 -9.360d4rvca_ c.37.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1337888]}  ali model 3D-neighbors follow..  18  25.VDRGEMVALIGLNGAGKSTTI--RLADGPETYRRQFAYIPETPVLYEELTEAEYERRLPPLLREFRLERRLSSFPAHFSKGMKQKVMIVCAFLLEPPLYIIDE---LDPLAIHALLERMNEQKAKGAGILLST.... 190
65 -9.350d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  19.......RLIEASAGTGKTFTIAALYLRLLLGLGEELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERLLEEIDDKAQAAQLLAERQMDEAAVFTIH................................ 130
66 -9.220d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  32..RIHHAYLFSGTRGVGKTS--IARLLAKGLN--ETGITATP------GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRD--LLDNVQYAPARGRFKVYLIDEVHMLSRHSFNA--LLKTLEEPPEHVKFLLATTDP 155
67 -9.190d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}  ali model 3D-neighbors follow..  11  43.......VLLEGPPHSGKT------ALAAKIAEESNF-ICSPDKMI-----------------------------FSETAKCQAMKKIFDDAYKSQLSCVVVDDIERFSNLVLQALLVLLKKAPPQGRKLLIIGTT.. 150
68 -9.180d2f1ra1 c.37.1.0 (A:4-161) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  1......ILSIVGTSDSGKTT-LITRMMPILRERGLRVAVVKRHAHGDFEIDKEGKDSWKIYNSGADVVIASPVKLAFIRRVEGNDLDWIYERYLSDYDLVITEGFSKAGKDRIVVVKKPEEVEHFRQGRILAVVCDER 134
69 -9.140d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  12  41..HHYPRATLLGRPGTGKTVTL--RKLWELYKDKTTARFVYINGFIYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHL--------RERDLYMFLVLDDAFNLAPDILSTFIRLGQEADKLGAFRIALVIV.. 164
70 -9.110d2vp4a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  7..TQPFTVLIEGNIGSGKTTYL--NHFEKYK--NDICLLTEPVVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYC--FVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQIIYLRTSPE 147
71 -9.070d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-Zoster virus [TaxId: 10335]}  ali model 3D-neighbors follow..  12  1VKMGVLRIYLDGAYGIGKTT-AAEEFLHHFAITPNRILLIEPRNLAGEDAICGIYGTQTRRLNGDVSPEDAQRLTAHFQSLFCSPHAIMHAKISALMDIMLSDRHPIASTICFPLSRYLVGDMSPAALPLVVCTVSLP 171
72 -9.030d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}  ali model 3D-neighbors follow..  27  3..PKGINILITGTPGTGKTS--MAEMIAAELDG......................................................................................................... 31
73 -9.000d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  2.....NVWQVVGYKHSGKTT-LMEKWVAAAVREGWRVGTVKHHGHGGEPARPEGVDSVRHERAGAVATAVEGDGLLQLHLRLWRLDDVLALYAPLRLDLVLVEGYKQERHPKVVLVRSEEDWASLQHLANIRAVIA.. 133
74 -9.000d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}  ali model 3D-neighbors follow..  10  30..ESPTAFLLGGQPGSGKTS-----LRSAIFEETQGNVIVIDNDTFKQQHPNF---------DELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVI--EGTGRTTDV--PIQTATMLQAKGYETKMYVMAVPK 147

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.