current user: public

If you have questions about the server, please let us know.

Query: d1ysra_ d.122.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
6 -39.600d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  19  1..RVTESIHKVAERVVTLVSELPDNVRLIRDYDPSLPLAHDPDQIEQVLLNIVRNALRTRTAFQLTLHGERYRLAARIDVEDNGPGIPPHLQDTLFYPMV---SGREGGTGLGLSIARNLIDQHSGKIEFTSWP-GHTEFSVYLPIRK 156
7 -39.100d4e01a2 d.122.1.4 (A:186-375) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  19  9....RLSPKKIIEKWVDFARRLCEHKRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLRHID 189
8 -30.400d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}  ali model 3D-neighbors follow..  21  16.....................................FPNPARALYQTVRELIENSLDATDVHGILPNIKDARQIYKVNVVDNGIGIPPQEVPNAFGRVLYSSKYVNGMYGLGVKAAVLYSQMHQDKIEIETSPNSKRIYTFKLK... 136
9 -29.100d1th8a1 d.122.1.3 (A:1-136) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  19  36........................................ELTEIKTVVSEAVTNAIIHGPNGIVSISVIIEDGVVHLTVRDEGVGIP--DIEEARQPLFTTKPELE-RSGMGFTIMENFM----DEVIVESEVNKGTTVYLK..... 135
11 -11.800d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  2........................................DTTRPNHLGQEVIDNSVDEALAGRVDVILHADQS---LEVIDDGRGMPVDIHPE--------EGVPAVELILCISVVNALSK.......................... 75
12 -11.700d4k4oa1 d.122.1.0 (A:18-224) automated matches {Enterococcus faecalis [TaxId: 226185]}  ali model 3D-neighbors follow..  24  17........................................SGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKVFGKFGGGGYKVSGGLGVGSSVVNALST.......................... 113
13 -10.900d1q1da1 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  51.....................................VPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEH--TIEVKNDGKGIPIEIHNKIFSNYDDDEKKVTGGNGYGAKLCNIFST.......................... 148
14 -10.500d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  5..........................................LSLSTAVKELVENSLD-AGATNIDLKL-KDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFGFRGEALSSLCALSDVHNGKIIQKTPYPRGTTVSVQ..... 132
15 -10.200d1b63a2 d.122.1.2 (A:1-216) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  22  21..........................................ERPASVVKELVENSLD-AGATRIDIDIE-RGGAKLIRIRDNGCGIKKDELALALARHATSKIASLGFRGEALASISSVAYAEGRDMNVTVKPAAGTTLEVL..... 148
16 -9.870d3cwva1 d.122.1.0 (A:8-206) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  13  19........................................GEYGLHHLVYFLLDVAYEEARRGECRDVVLEVGGDGSIALFCTSRTVTAENLVRV-AGFLGRPPGDGWGWDSMLVVSLALSS.......................... 102

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.