current user: public

If you have questions about the server, please let us know.

Query: d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst FQLLEPYNIKANLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAVFSDAKKENELTPSLVICPLSVLKNWEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRDTRLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYRIALTGTPIENKVDDLWSIMTFLNPGLLGSYSEFKSKFATPIKKGDNMAKEELKAIISPFILRRTKYDKAIINDLPLast
1 -124.000d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors  100  1FQLLEPYNIKANLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAVFSDAKKENELTPSLVICPLSVLKNWEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRDTRLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYRIALTGTPIENKVDDLWSIMTFLNPGLLGSYSEFKSKFATPIKKGDNMAKEELKAIISPFILRRTKYDKAIINDLP 230
2 -66.200d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebrafish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  28  45.HVVVDPVLSKVLRPHQREGVKFLGRRIENSYGCIMADEMGLGKTLQCITLIWTLLKQSPIDKVIVVSPSSLVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSTPILIISYETFRLHAELHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKGREQKLQELISIVNRCLIRR............ 298
3 -23.600d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  20  66.......DAEISLRDYQEKALERWLVDKR----GCIVLPTGSGKTHVAMAAINELST-----PTLIVVPTALAEQWKERLGIFGEE-YVGEFSGRIKELK----PLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHL--PAESYVQIAQMSIAPFRLGLTATF.................................................................... 205
4 -21.800d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  107.....SGNKRIEPHWYQKDAVFEGLVNRR----RILNLPTSAGRSLIQALLARYYLENYEGKILIIVPTTALTTQMADDFVDYRSHAMIKKIGGGKDDKYKNDAPVVVGTWQTVVKQPKEWFSQFGMMMNDECHLATGKSISSI-ISGLNNCMFKFGLSGSLRDGK................................................................ 266
5 -14.800d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  20  9..................................VLDFHPGAGKTRRFLPQIL-AECARRRLRTLVLAPTRVV---LSEMKEAFHGLDVKFHTQAFSAHGSGREVIDAMCHATLTYRMPTRVVNWEVIIMDEAHFLDPASIAARGWAAHRARANEILMTATP.................................................................... 137
6 -14.600d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  17  9...........QPRIYQEVIYA-----KCKETNCLIVLPTGLGKTL-IAMMIAEYRLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVAEERSKAWARAKVIVATPQTIENDLLISLEDVSLIVFDEAHRANYAYVFIAREYKRQAKNPLVGLTASPGSTP................................................................ 170
7 -13.700d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  77...............................MDRLVCGDVGFGKT---VAMRAAFLAVDNHKQVAVLVPTTLLANFRDRFANWPVRIEMISRFRSAKEQT-GKIDILIGTHKLLQSDVKFKDL--GLLIVDEEHRFGVRHKERIKAMRA------LTLTATPIPRTL............................................................... 218
8 -13.100d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  14............LKGIYAMKFQKPSKIQERALPLLLHNQSGTGKTAASLTMLTRVNPEDASPQAICLAPSRELARQTLEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLRRKLMQLQKIKIFVLDEADNMLDQQDQCIRVKRFLPKDTQLVLFSATFADAVRQY............................................................ 191
9 -13.100d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  16  78......KSLPFKLTNAQKRAHQEIRMISEKPMNRLLQGDVGSGKTVVAQLAILDNYEAG---QTAFMVPTSILAIQHYRRTV---NIHVALLIGATTPSEKEQIDVVIGTHALIQEDVHFKNL--GLVIIDEQHRF----KQREALMNKGKMVDTLVMSATPIPRSMA.............................................................. 247
10 -12.700d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  16  12..................................HLHAPTGSGKSTKVPAAYAAQGYK-----VLVLNPSVAAT--LGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGVLATATP.................................................................... 136
11 -11.900d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  21..FERPSPVQLKAIPLGRCGLDLIVQAKS-----------GTGKTCVSTIALDSLVLENLSTQILILAPTR-IHSVITAIGIKMEGLECHVFIGSQDKTRLKKCHIAVGSPGRIKELDYLNPGSIRLFILDEADKLLEEGSQINWIYSSLPASKQMLAVSATYPEFLANALTKY........................................................ 196
12 -11.300d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  18  36..VGEPRAIQKMWAKRILRKESFA-----------ATAPTGVGKTSFGLAMSLFLALKGKR--CYVIFPTLLVIQAAETIRKYAEKAGIGYYHGRIPKRELRNFKIVITTTQFLSKHYRELG-HFDFIFVDDVDAILKASKNVDKLLHLL................................................................................ 183
13 -11.300d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  19  18...............LKEEGIEELFPPQAEAVEKVFSGKTAAGKTL--LAEMAMVREAIKGGKSLYVVPLALAGEKYESFKKWEKGLRIGISTGDYEDEHLGDCDIIVTTADSLIRNRASWIKAVSCLVVDEIHLLDSEKEILVTKMRRMNKALRVIGLSATAPN................................................................. 184
14 -11.100d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  18  13............LEALHGRGLTTPTPIEAAALPLALEGRTGTGKTLPIAERLAPSQERGRKPRALVLTPTELALQVASELTAVAPHLKVVAVYGKQKEALLRGADAVVATPGRALRQGVLDLSRVEVAVLDEADEMLSMGEEVEALLSATPPSRQTLLFSATLPSWAKRL............................................................ 192
15 -10.100d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  22............LRGVFGYGFEEPSAIQQRAIMPIIEGQSGTGKTGTSIAALQRIDTSVKAPQALMLAPTELALQIQKVVMALAFHMDIKVH--VEDAEGLRDAQIVVGTPGRVFQRRRFRTDKIKMFILDEADEMLSSGEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKF........................................................ 203
16 -9.890d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  13............LRAIVDCGFEHPSEVQHECIPQAILGKSGMGKTAVVLATLQQLEPVTGQVSVLVMCHTR-ISKEYERFSKYMPNVKVAVFFGGLEVLKKNCPHIVVGTPGRILRNKSLNLKHIKHFILDECDKMLEQRRDVQEIFRMTPHEKQVMMFSATLSKEIRPV............................................................ 194
17 -9.700d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  32LGWTKPTKIQIEAIPLALQGRDIIGLAET-----------GSGKTGAALPILNALLETPQRLFALVLTPTELAFQISEQFEALGSSIGVVIVGGIDSMSQSLALHIIIATPGHLENTKGFNLRALKYLVMDEADRILNMDTEVDKILKVIPRDRKTFLFSATMTKKVQKL............................................................ 205
18 -9.650d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  32.........KKTLKGLQEAQYRLVTEIQKQTIGLALQGKTGSGKTLAFLVPVLEALYRLQWTSVLIISPTR-TFEVLRKVGKNHDFSAGLIIGGKDEAERINNINILVCTPGRLDETVSFHATDLQMLVLDEADRILDMGDTMNAVIENLPKKRQTLLFSATQTKSVKDL............................................................ 217
19 -9.550d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  14  14..................................VLDLHPGAGKTRRVLPEIV-REAIKKRLRTVILAPTRVVA---AEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLPIRVPNYNLNIMDEAHFTDPSSIAARGYISTRVEMGEIFMTATP.................................................................... 142
20 -9.450d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  14............LMGIFEMGWEKPSPIQEESIPIALSGKNGTGKSGALIPLLERLDLKKDNIQAMVIVPTRELALQVSQVSKHMGGAKVMATTGGTNLRD-DTVHVVIATPGRILKKGVAKVDHVQMIVLDEADKLLSQDQIMEDIILTLPKNRQILLYSATFPLSVQKF............................................................ 193
21 -9.030d4lcba_ c.37.1.0 (A:) automated matches {Acidianus hospitalis [TaxId: 933801]}  ali model 3D-neighbors follow..  16  38................................GILLYGPPGNGKTM-----LAAAVANEIDSYFIHVDAASIMSKWLGEAEKNVAKI-------------------------NTAREYSKKDNKPAIIFVDEIDALLGTYTSEVGGEVRVRNQFLKEMDGIMDKNENYMVYVIGATNKPWRLDEPRRFQKRIYVPLPDFNQ------RLALFKYYTSKVKLGNVDLQEL. 201

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.