current user: public

If you have questions about the server, please let us know.

Query: d2affa_ b.26.1.2 (A:) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst PTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENELast
1 -60.000d2affa_ b.26.1.2 (A:) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1PTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENE 98
2 -51.800d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  24  1SGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQIS 98
3 -49.100d3po8a1 b.26.1.0 (A:3-97) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  28  1..GTSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQE-WQLADGDVIRLGHSEIIVRMH 95
4 -48.500d2xt9b_ b.26.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  27  2SGSALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAEFRLEGGEFQVVDVGSLNGTYVNREPVDSAV-LANGDEVQIGKFRLVFLT. 97
5 -42.800d1mzka1 b.26.1.2 (A:180-298) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  22  1.SWLFLEVIAGPAIGLQHAVNSTSVKLGRVSPSDLALKDSEVSGKHAQITWNSTKWELVDMGSLNGTLVNSHSISHPVELASDDIITLGTTTKVYVR. 113
6 -42.100d3gqsa_ b.26.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 272561]}  ali model 3D-neighbors follow..  23  1.SRFLLKVLAGANIGAEFHLDSGTYIVGSDPQADIVLSDMSISRQHAKIIIGDNSVLIEDLGSKNGVIVEGRKIEHQSTLSANQVVALGTTLFLLVD. 99
7 -42.000d1uhta1 b.26.1.2 (A:8-112) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  23  3TPSLRLVFVKGPREGDALDYKGSTIRVGRIVRNEIAIKDAGISTKHLRIESDSGNWVIQDLGSSNGTLLNSNALDTSVNLGDGDVIKLGEYTSIL... 101
8 -39.900d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  22  16..PIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVNSNQLLSQGDEITVGVGVESDILS 114
9 -35.800d2piea2 b.26.1.2 (A:13-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2GGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVPLMISRNHCVLKQNEGQWTIMDNKSLNGVWLNRARLERVYSIHQGDYIQLGVPLENKENA 106
10 -34.000d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3`-phosphatase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  1.GRLWLESPPGEAPPIFLPSDGQALVLGRGPLTQV--TDRKCSRTQVELVADETRTVAVKQLGVNPSTTGTQELKLEGSLGVGDTLYLVNGLHPLTLR 98
11 -33.900d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1PWARLWALQDG---FANLECVNDNYWFGRDKSCEYCFDEPTYSKKHFRIFRENSYIAYIEDHSGNGTFVNTELVGKRRPLNNNSEIALSLSRNKV... 107
12 -33.700d1lgqa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  5...GRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFSNKLVSGDHCRIVVDSGQVTLEDT-STSGTVINKLKVKQTCPLQTGDVIYLVYRKNEPEHN 103
13 -31.400d3kt9a_ b.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  3...RVCWLVRQDSRHQRIRLHLEAVVIGRGPETKI--TDKKCSRQQVQLKAENKGYVKVKQVGVNPTSIDSVVIGQEVKLQPGQVLHMVNELYPYIVE 99
14 -31.100d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  19  6...LTLKPLPDSIIQESLEIGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAIWYCHT-GTNVSYLNNNRMGTKFLLQDGDEIKIIWDK...... 112
15 -23.600d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  24.................YRLQLSVTEVGTFDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVDGQRISETTMLQSGMRLQFGTSHFKFVD. 106
16 -22.700d3fm8a_ b.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  21.....................KEHTLIGSANSQDIQLCGMGILPEHCIIDITSEGQVMLTPQKNTRTFVNGSSVSSPIQLHHGDRILWGNNHF..... 92
17 -19.400d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  19.................YHIKDGVTRVGQV-DMDIKLTGQFIREQHCLFRSDGEVVVTLEPCEGAETYVNGKLVTEPLVLKSGNRIVMGKNHFRFNH. 102
18 -9.020d1udxa3 d.242.1.1 (A:341-416) Obg GTP-binding protein C-terminal domain {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  17  1.....................QAGVEVVPVAEGVYEVRAPEVERYLARIKGDLMEAAGYLQEVFRRQGVEAA---RAKGVRAGDLVRIGGLEFEYIPE 75

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.