current user: public

If you have questions about the server, please let us know.

Query: d2clya1 f.52.1.1 (A:79-183) ATP synthase subunit b, mitochondrial {Cow (Bos taurus) [TaxId: 9913]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst GEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQLast
1 -61.800d2clya1 f.52.1.1 (A:79-183) ATP synthase subunit b, mitochondrial {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors  100  1GEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQ 105
2 -6.810d1mpga2 d.129.1.2 (A:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  53...............................................DIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRL............ 98
3 -5.500d2xola1 a.184.1.1 (A:1-166) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  10  89...................................................DHIAVELAFMSKLVEREISLAQQMKEEELYKIRAAQHRFIKAHLQPLV...... 136
4 -5.350d2bgga2 c.44.3.1 (A:11-170) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  49.SLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLP----EYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNL.. 146
5 -5.310d1b9la_ d.96.1.3 (A:) 7,8-dihydroneopterin triphosphate epimerase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  27.................................................NRQDIVINVTIHYPADKARTSEDINDALNYRTVTKNIIQHVENNRLLEKLTQDVLD 84
6 -5.120d4i8va_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  225.SFMQKMVKEHYKTFEKGHRDITDSLIEHCQEKQSDEKIINIVLDLFGAGFDTVTTAISLMYLVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLMEAFILETFR 342
7 -5.110d2fdva_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  217.DFIAKKVEHNQRTLDPNSPRRMQEEEKNPNTEFYLKNLVMTTLNLFIGGTETVSTTLRFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMMEAVIHEIQR 332
8 -5.080d2ojda1 a.104.1.1 (A:39-501) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  217.DFLSRLIEKASVNRKPQLPQEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMTEAVLHEVLR 332
9 -5.050d2o90a_ d.96.1.0 (A:) automated matches {Escherichia coli}  ali model 3D-neighbors follow..  14  24.................................................IEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAETVVSHVEGARLVERVAEEVAE 81
10 -4.910d5cfla1 d.387.1.0 (A:193-377) automated matches {Nematostella vectensis [TaxId: 45351]}  ali model 3D-neighbors follow..  116.............................................LYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVPDRDLADVMLRKLKD 178

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.