current user: public

If you have questions about the server, please let us know.

Query: d2f6ia1 c.14.1.1 (A:179-366) Clp protease, ClpP subunit {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst DIKDMKKDVKLFFFKKRIIYLTDEINKKTADELISQLLYLDNINHNDIKIYINSPGGSINEGLAILDIFNYIKSDIQTISFGLVASMASVILASGKKGKRKSLPNCRIMIHQPLGNAFGHPQDIEIQTKEILYLKKLLYHYLSSFTNQTVETIEKDSDRDYYMNALEAKQYGIIDEVIETKLPHPYFNLast
1 -96.400d2f6ia1 c.14.1.1 (A:179-366) Clp protease, ClpP subunit {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}  ali model 3D-neighbors  100  1DIKDMKKDVKLFFFKKRIIYLTDEINKKTADELISQLLYLDNINHNDIKIYINSPGGSINEGLAILDIFNYIKSDIQTISFGLVASMASVILASGKKGKRKSLPNCRIMIHQPLGNAFGHPQDIEIQTKEILYLKKLLYHYLSSFTNQTVETIEKDSDRDYYMNALEAKQYGIIDEVIETKLPHPYFN 188
2 -89.100d1yg6a_ c.14.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  40  11SRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN...... 193
3 -82.100d4gm2a_ c.14.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}  ali model 3D-neighbors follow..  37  2..........SLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKKPIHLYINSTGNGITDVISIVDVINYISSDVYTYCLGKAYGIACILASSGKKGYRFSLKNSSFCLNQSYSIPFNQATNIEIQNKEIMNTKKKVIEIISKNTEKDTNVISNVLERDKYFNADEAVDFKLIDHILEK........ 183
4 -11.000d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  15  25......................NSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLWLRLYQSNLVLVSAINGACPAGGCLVALTCD---RILADNPRYCIGLN---------ETQLGIIAPFWLKDTLENTIGHR------AAERALQLGLLFPPAEALQVGIVDQVVPEEQVQST.. 192
5 -10.300d3gf3a2 c.14.1.4 (A:292-587) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  88..............KQNSVGIGGKLYRQGLIKMNEFVTLCARDR--PLIWLQDTTGELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNSIGTGACEYYVMPGETAAN-KAKKAGEDLQPIIGKMNDMIQMYTDKS-----------------RPKYCTEKGMVDEIVDMTEVRPYI. 263
6 -10.200d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  25......................NAINTEMYHEIMRALKAASKDD--SIITVLTGNGDYYSSGNDLVGCFIDFPKPLIAVVNGPAVGISVTLLGLFD---VYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKK-----------------LTAGEACAQGLVTEVFPDSTFQKEV. 193
7 -9.960d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  10  23......................NAFSLDMWQRLPELLAEASGDDALRVLVVKSANGGAFCAGADIQYELARFRLPTVAMVEGDCIGGGCGIALACD---RIAAPAARFGITPAKLGLVYPLHDVKLLVDLV-----------------GPGQARRLMFTGGLIDANEAHRIGLVELLGESEDALVG.. 190
8 -9.740d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  26......................NSLNPEVMREVQSALSTAAADDSKLV--LLSAVGSVFCCGLDFVNTFIQFKKPIIVAVNGPAIGLGASILPLCD---VWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRK-----------------LTAQEACGKGLVSQVFWPGTFTQEV. 194
9 -9.710d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  30......................NALDDAMFEGIVAAGHHLHSVKGVRC-VVLSGAGRSFCAGLDLAMVWRKLPMPVIAAVHGVCFGGGLQVASGAD---RFITPDARLAVMEVKWGLVPDMAGYALWRGNV-----------------RDDVLRELTYTHREFSGEEAVRFGFATHVADDPLAGA... 200
10 -9.670d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  26......................NAMNRAFWRELVECFQKISKDSDCRA-VVVSGAGKMFTSGIDLFTVIEKCPKPVIAAIHGGCIGGGVDLISACD---RYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGNRSLVNELTFTARK----------------MMADEALDSGLVSRVFPDKDVM.... 200
11 -9.610d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  22......................NALNSQLVEELTQAIRKAGDGSARAI--VLTGQGTAFCAGADLHKAMDASPMPVVGAINGPAIGAGLQLAMQCD---RVVAPDAFFQFPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEK-----------------LTAEIALHTGMANRIGTLADAQA... 179
12 -9.580d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  11  24......................NALYGELYLWIAKALDEADQNKDVRV-VVLRGAEHDFTAGNDMKDSAARLSKPLIIAVKGVAIGIGVTILLQAD---VFADNTALFQIPFVSLGLSPEGGASQLLVKQAGYHKAAELLFTAKK-----------------FNAETALQAGLVNEIVEDAYATA... 189
13 -9.470d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  27......................NSLTVPVITGIADAMEYAATDPEVKV-VRIGGAGRGFSSG-RLVRAIAALPHPVVAVVQGPAAGVGVSIALACD---VLASENAFFMLAFTKIGLMPDGGASALVAAAVGRIRAMQMALLPER-----------------LPAAEALAWGLVTAVYPADEFEAE.. 193
14 -9.460d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  24......................NALIGEMYAALAEAFAKGEADDDVNV-FLILGSQTDFSAGNDLPDAVAGARKPVVAAVRGAAIGIGSTLLPHCD---VYAAPGTRFHMPFINLGIVPEAGSSQTMPALAGHRRAAEMLMLGEP-----------------FGVDTAEAVGLINGVVPGEDLEET.. 184
15 -9.340d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  28......................NALTKDMCLEIQELMPQLDADPDVAV-VVLRGAGDTFCAGASIDSAIAALSKPAVALVDGACMGGGWQIASACD---IIANERAVIGLTPAKIGIIYPRPGLERLVRLV-----------------GHANAKYILLTGQTFSAPEARALGLVADVVPSESFEEK.. 194
16 -9.310d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  26......................NALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDITRMIQKFPKPIISMVEGSVWGGAFEMIMSSD---IIAASTSTFSMTPVNLGVPYNLVGIHNLTRDA-----------------GFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDF.. 190
17 -9.260d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  24......................NALSVDMWAAIPGLVAEANANPDVKLILIHGGDAGAFAAGADILDAIENSEKPVIAAIEGACVGGGVSLAMAAD---RVAGEGAKFGVTPGKLGLVYPAGDTRRLLAAV-----------------GPGATKDILFTGRIFTAGEAKSLGLIDRLVEKGTALEA.. 191
18 -9.190d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  23......................NALGPEIYAAGIEALNAAENNPEIRS-VVITGEGAVFCAGGNLIDSIRTYPKPVIAAVEGAAAGAGFSLALACD---VVAASNAVFVMSYSTVGLSPDGGGSWSLARSLPRALASELLMGGER-----------------ISAQRLHDLGLVNKVASAGDALSE.. 190
19 -9.170d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  13  71............IVANQPSVMSGCLDINASDKAAEFVNFCDSFN--PLVQLVDVPGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGSYLAMCNRDLGAVYAWPSAEIAVMGAEGAAN--RKEIKAADDPDAMRAEKIEEYQNAFN-----------------TPYVAAARGQVDDVIDPADTRRKI. 240
20 -9.090d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  29......................NAMSPTLNREMIDVLETLEQDPAAGV-LVLTGAGEAWTAGMDLWKLLRMYAKPTIAMVNGWCFGGGFSPLVACD---AICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLMYIMTGKT-----------------FGGQKAAEMGLVNESVPLAQLREV.. 198
21 -9.040d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  25......................NTINDTLIEECLQVLNQCETSTVTVV--VLEGLPEVFCFGYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATD---AIADQTASFSLSELLFGL----------------YPACVLPFLIRRIGRQ--KAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLR.. 189

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.