current user: public

If you have questions about the server, please let us know.

Query: d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst VWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPLast
1 -97.300d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1VWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNP 263
2 -71.700d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  30  9...RVEQLAEQRQVIEAGGGERRVEKQHSQGKQTARERLNNLLDPHSFDEVGAFR------------KHRTTLFGMDKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGKMFFANVKLS-GVVPQIAIIAGPCAGGASYSPAL-TDFIIMTKKAHMFITGPQVIKSVTGEDVTDELGGAEAHMISGNIHFVAEDDDAA--ELIAKKLLSFLPQNN. 253
3 -57.900d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  14  32...VESDIHESIKKA-LDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNP-------------------ENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYH-SISPTILIAHQDANMAVGGAGILSGMNPKGYIPAPGSVPIHYDTGFFREVYQNDL--GVIDGIKKYISYLPA... 289
4 -41.000d3tdca1 c.14.1.0 (A:1719-2042) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  6....KDLLQAKRFQAQTLGTTYIYDGSPDKYPKDILTYTELVLDSGQLVEMNRLPGGN------------------EVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIGSFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGLGVENLRGSGMIAGESSL-AYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVE-NSHIILTGASALNKVLGREVNNQLGGVQIMHYNGVSHITVPDDF--EGVYTILEWLSYMPKDN. 324
5 -32.800d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  17  26...........................DGKKGYDVRDVIAKIVDWGDYLEV---------------------------KAGYATNLVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGSYLAMDLGADAVYAWPSAEIAVMGAEAANVIFRKEIKNAFNTPYVAAARGQVDDVIDPADTRRKIASALEMYATKRQTRP 255
6 -32.100d2f9ia1 c.14.1.0 (A:1-314) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  12  55.....................DRVQIARLQERPTTLDYIPYIFDSFMELH-------------------------GDRNFRDDPAMIGGIGFLNGRAVTVIGQQIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIAAETMKITAAHKDIEQQALAIKSAFVAQLDSLESLSRDE. 297
7 -28.000d3gf3a2 c.14.1.4 (A:292-587) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  13  28...........................NQKRPYDIYEVIARLFDNSEFSEY---------------------------KKGYGPEMVTGLAKVNGLLVGVIANVQGLIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQVFSIGTGACEYYVMPGEAANAMYSRKLVTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSIC 278
8 -18.900d3tdca2 c.14.1.0 (A:2043-2451) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  34...........................GRPHPTLKGTWQSGFFDHGSFKEI---------------------------MAPWAQTVVTGRARLGGIPVGVIAVETRTVGQVWFPDSAYKTAQAIKDFNREKLPLMIFANWRGFSGGMKDMYDQVLKFGAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDAIEMYADKESRGGVLEPEGTVEIVAVQFADFHDTPGRMLEKGVISDILEWKTARTFLYWRLR.......... 314
9 -13.100d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  14  12...........................................................................................DLRDNGVCVVTLNRPDKRNALDVATIEELVTFFSTAHRKGVRAVVLTGAGGLDLVEADDFMHVCLRWHEAFNKMEYGGVPIIAALRGAVVGGGL-ELASAAHLRVMDQSTYFALGATIRVSDMIGKYRMIDM-QGQEAADLGLAQYITEGSSFDKAMELADKIASNLP.... 207
10 -13.100d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  16  10.................................................................................................VLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGGADLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGL-QLAMQCDLRVVAPDAFFQFWSIRRLSSLVGHGRARAM-TAEIALHTGMANRIGTLADAQAWAAEIAR.......... 186
11 -12.400d2q35a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}  ali model 3D-neighbors follow..  12  11.................................................................................................VVQITMKDESSRNGFSPSIVEGLRHCFSVVAQNQYKVVILTGYGGASKEFLIRKTRGEVEVLDLSGLILDCEIPIIAAMQGHSFGGG-LLLGLYADFVVFSQESVYATATSLILREKLGSELAQEM-RGKELAERGIPFPVVSRQDVLNYAQQLGQKIAKSPR... 195
12 -11.400d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  8...........................................................................................RKQDGFTHILLSTKSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGGLDFIYKRESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGA-SILPLCDVVWANEKAWFQTCSTVMFPKIMGGASANEM-TAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNP... 206
13 -11.300d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  14.................................................................................................VAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELPSGGRDTRMIQKFPKPIISMVEGSVWGGA-FEMIMSSDLIIAASTSTFSMVGIHNLTRDAGFHIVKEL-TAQRALAVGILNHVVEVEEL---EDFTLQMAHHISEKAP 203
14 -11.200d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  14  13.................................................................................................VCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPGADFQEGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGL-GFVSATDIAIADQTASFSLSVLPFLIRRIGRQKAHYM-SVQEASEWGLIDAFDAESDVL-----LRKHLLRLRRLNK 200
15 -11.200d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  16  11.................................................................................................ASLIVLSRPEKLNAINLEMLADLADQFSKAEKEDTRVIVITGYGGADINMPASAYSFRLKMNSIAQRIRKSDKPVIALLKGYSMGGGL-ELAESADIRIAMSDAVIGQGGNVILPKLVGRGSAAYL-NAQEAMALGLVDEVVDDEAKAWKIID............. 189
16 -11.000d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}  ali model 3D-neighbors follow..  14  5...........................................................................................SNHGRVAVITLNRPERLNAWTTPMRETIIDALERFNRDPEVAAIIMTGAGGQDLSEGERAVAWVKEWQRYYTALRSLSKPLVMALNGTAAGSA-FQVALLGDIRVGHPGVRMGQTGPWIMNAMLGMSRTIEL-EAEECHRIGLIHHLVDEDKVFDKALEIATELAAKP.... 198
17 -10.900d4qiia_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  12  33.................................................................................................TVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQYGSAYLARQVGQKFAREI-TAEQMHQMGAVNAVAEHAEL---ETVGLQWAAEINAKSP 241
18 -10.900d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  11  10.................................................................................................VRVITLDHPNKHNPFSRTLETSVKDALARANADSVRAVVVYGGAGGDFNESEDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMG-FQFALMFDQRLMASTANFVMVGAAILGFTHGFSTMQEI-DAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPA... 200
19 -10.900d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  13.................................................................................................ITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGGNDLTNEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISV-TLLGLFDAVYASDRATFHTCSSYTFPKIMSPAKATEM-TAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPP... 205
20 -10.800d4k29a_ c.14.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  14  13.................................................................................................VARITLNRPERTNALDQEMLGEINAAMDAAEADGVKAVIVRGAGGFDLKAQMEARPALRKDFDTVMRFWHCPKPTIAAVRGPCLAGAC-ELALACDMTIATEDAFFGEIVVMLLPWIVGPKIAKEI-PARRAAEIGMVNRVVDGDGLDAEALRIARHIGAIDP... 203
21 -10.800d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  13  10...........................................................................................TLSDGVFSVTINRPDSLNSLTVPVITGIADAMEYAATDPEVKVVRIGGAGGAGISAGVPPDEIILEINRLVRAIAALPHPVVAVVQGPAAGVGV-SIALACDVVLASENAFFMLGASALVAAAVGRIRAMQM-PAAEALAWGLVTAVYPADEFEAEVDKVIARLLSGPA... 206
22 -10.700d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  15  16.................................................................................................VASVEISNLAQRNALTKDMCLEIQELMQLDADPDVAVVVLRGAGGASISEPQPDGSTADHLSRADSAIAALSKPAVALVDGACMGGGW-QIASACDFIIANERAVIGLPGLERLVRLVGHANAKYI-SAPEARALGLVADVVPSESFEEKCAALVRSLR....... 203
23 -10.600d3pe8a_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  14  12.................................................................................................VRTLTLNRPQSRNALSAELRSTFFRALSDAQNDDDVDVVIVTGADPVFCAGLKELGDTTELPDISPKWPDMTKPVIGAINGAAVTGGL-ELALYCDILIASENAKFADGLSVRLPQKVGVGLARRM-SAQDALRAGLVTEVVAHDDL---LTAARRVAASIVGNNQ 192
24 -10.600d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  15  17.................................................................................................IAFVILNRPEKRNAMSPTLNREMIDVLELEQDPAAGVLVLTGAGGMDLKEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGG-FSPLVACDLAICADEATFGLLVSKAMADTVGHRQSLMY-GGQKAAEMGLVNESVPLAQL---REVTIELARNLLEKNP 211
25 -10.500d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  18  12.................................................................................................LAEIVLNKPERRNALSVDMWAAIPGLVEANANPDVKLILIHGGDGADISEEDAAKASGQRIAQALDAIENSEKPVIAAIEGACVGGGV-SLAMAADLRVAGEGAKFGVGDTRRLLAAVGPGATKDI-TAGEAKSLGLIDRLVEKGTA---LEAARVWAGEIAAISQ 204
26 -10.400d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  14  13.................................................................................................IATVTLNRPDRMNALNLPMWRGLAEAFTISADRSIHVVILRGAGGADIEEAEQAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGL-ELACCCDIRLSAKSGKFGVPELAQIRRVAGPAAALEI-DADEAAAKRLVNRVVEDDAM---DAEVAATAKRIAAGAP 205
27 -10.200d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  14  11................................................................................................PVTTVIIDRPEARNAVNGPTAAALFAAFEFDADDTASVAVLTGANGADLKAPEANQVHREGPGPMGPSRMDLSKPVIAAISGYAVAGGL-ELALWCDLRVVDEDATMGVGGTVRLPRLIGHSRAMDL-DAAEAYAIGLANRVVPTGQARQAAEELAADLARLPQ... 199
28 -10.200d3gowa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  13  5...........................................................................................ERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGGQDLTEKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGM-SLALWGDLRLAAVGASFTTGLSFLLPRLVGLAKAQEL-SAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPT... 198
29 -10.200d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  12  12.................................................................................................VQVVRMNRPDKKNALIGEMYAALAEAFAKGEADDVNVFLILGSQGNDLPDFLTWEALSGSVADRIRAVAGARKPVVAAVRGAAIGIGS-TLLPHCDLVYAAPGTRFHMGSSQTMPALAGHRRAAEM-GVDTAEAVGLINGVVPGEDLEETAMAAARKLAAKPR... 197
30 -10.100d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  11  1..........................................................................................GAIEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENNPEIRSVVITGEGGGNLQRPEVQAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGF-SLALACDFVVAASNAVFVMGGSWSLARSLPRALASEL-SAQRLHDLGLVNKVASAGDALSEALRMAGQLNARAP... 203
31 -10.100d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  12  6...........................................................................................EIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGGADLTWEEENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGA-GLAAACDIAIASTSARFCFSEVKLVVRAIGERAAKML-DATRAYSLNLVQHCVPDDTLLEFTLKYASQIS....... 198
32 -10.100d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  13  6...........................................................................................RIEGHVAHVRLNRPQGLNAITQEMDDLLLDAWTEVNANSDIWAVVLSAEGGADVSGGAER-ALGGGLTGIGGPLVTCKKPMVAAVQGFCVGGG-FELAMCADIIVAADTAQFGLGVVHRAMRQLPYHIALQL-KADEARHYGLVNEVVPFAEL---EEAALRWASKLNAASP 199
33 -9.940d3tlfa_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  13  1...................................................................................DSFDTIKYEVDGHTATITLNRPDALNALSPHMITELRAAYHEAENDDRVWLLVVTGTGGADVKEYLSTYDQWEAPQEGTPPFRTMAKPVLTAVNGICCGAG-MDWVTTTDIVIASEQATFFDRELVRVSRVLPRSIALRM-SAQRAYELGLISEIVEHDRL---LERAHEIADIVNSNAP 211
34 -9.940d5e0nx_ c.14.1.0 (X:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  12  13.................................................................................................VALVTLNRPERMNSMAFDVMVPLLELLDLRHDNSVRVVILTGAGGADHKSPTYALRSMEVLDNVILALRRLHQPVIAAVNGAAIGGG-LCLALACDVRIAAHNAYFRLGLSYLLPRAIGTSRAFEI-DAAEAERIGLVSRTVPDDDLLETCFEMAQRMRGFSR... 210
35 -9.920d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}  ali model 3D-neighbors follow..  10  7...........................................................................................EVVNNVGWIRMNRAAKHNPFDAELRADLMTVLERVRDDADIRVLVLTSHPGGNLHVPAYWQQRIKTGLRFIHDMLNLGRPVIAAVDGPAFGAG-FALSLTADIVLASPRARFSMGALYLLPRAVGLQRAKEL-DAEEAHRLGLVMEVHESEALEQRAREIAESLVQAAP... 204
36 -9.920d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}  ali model 3D-neighbors follow..  13  13.................................................................................................VAEITIKLPRHRNALSVKAMQEVTDALNRAEEDSVGAVMITGAEGFYLRERDHFRIAALWWHQMIHKIIRVKRPVLAAINGVAAGGG-LGISLASDMAICADSAKFVCATSYSLARIVGMRRAMEL-YPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPT... 207
37 -9.900d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  20.................................................................................................VLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGGSFGLHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGL-ALALAADIAVVGKGTRLLDHAVLLWPLLVGMAKAKYH-TGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPK... 210
38 -9.880d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  12  12.................................................................................................IEIWTIDGESRRNAISRAMLKELGELVRVSSSRDVRAVVITGAGGADLKEEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGT-ELALACDLRVAAPAAELGLGGTQRLARLVGPGRAKDL-NAAEAFSVGLANRLAPEGHL---LAVAYGLAESVVENAP 202
39 -9.860d3myba_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  16  13.................................................................................................VVTLTLNRPQAFNALSEAMLAALGEAFGLAEDESVRAVVLAASGGHDLKEREYYEKLFARCTDVMLAIQRLPAPVIARVHGIATAAGC-QLVAMCDLAVATRDARFAVSGINVLSRNVGRKAAFEM-SADDAKGLGLVNRVVAPKALDDEIEAMVSKIVAKP.... 201
40 -9.790d2j5ga_ c.14.1.0 (A:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}  ali model 3D-neighbors follow..  20.................................................................................................ILEVRMHTNGSSLVFTGKTHREFPDAFDISRDRDNRVVILTGSGEIDFPSPREWDKTYWEGKKVLQNLLDIEVPVISAVNGAALLHS--EYILTTDIILASENTVFGDGVHILWPLALGLYRGRYF-TAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPT... 210
41 -9.700d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  13  22.................................................................................................GTVATLTLAAKMGSMGPAFWQEFPQALSELGDARVLIVR---SAGLDVKSNGAAIVPVDEMHAVTEGLAALPMPVIAAVHGWCIGAGL-ELIAGADLRLCSQDARFSLGGLQRLPHLIGRGRTAHL-DAATAERWGLVTEVLPDQD--ALFARAEALAEHLAALPA 214
42 -9.640d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  15  11.................................................................................................VARLLIDRADRRNAFSLDMWQRLPELLEASGDDALRVLVVKSANGADIAEAAFHAANQQAINRAQYELARFRLPTVAMVEGDCIGGGC-GIALACDMRIAAPAARFGIHDVKLLVDLVGPGQARRL-DANEAHRIGLVELLGESEDA................... 187
43 -9.610d4f47a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  13  12.................................................................................................TLIVTMNRPSRRNALSGEMMQIMVEAWRVDNDPDIRCCILTGAGGMDLKASFKDGSYDPSRIDALLKGRRLKKPLIAAVEGPAIAGGT-EILQGTDIRVAAESAKFGIGSAVRLVRQIPYTVACDL-TAAEAKEMGLVGHVVPDGQA---LTKALEIAEIIAANGP 204
44 -9.600d3swxa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 36809]}  ali model 3D-neighbors follow..  12  13.................................................................................................VLVIGLNRPAKRNAFDKTMLEELALALEYETDTDLRAAVLYGEGGLDLASGGASLTPEGGINPWQVDGRQLSKPLLVAVHGKVLTLGI-ELALAADIVIADETATFAQGATIRFPRTAGWGNAMRW-DAVEAHRIGIVQEIVPVGEH---VDTAIAIAQTIARQAP 203
45 -9.600d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  15  18.................................................................................................VAHVLLDRADKMNALDDAMFEGIVAAGHLHSVKGVRCVVLSGAGGLDLSSTERTHGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGL-QVASGADIRFITPDARLAVAGYALWRGNVRDDVLREL-SGEEAVRFGFATHVAD-----DPLAGAMELARVVAEKSP 212
46 -9.520d3qxza1 c.14.1.0 (A:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}  ali model 3D-neighbors follow..  11  11.................................................................................................VAVLTLHGPSTRNSFTVELGRQLGAAYQRLDDDAVRVIVLTGAPGAQISAAAETFAAPRNPDFSQPAAFELRTPVIAAVNGHAIGIGM-TLALHADIRILAEEGRYAILAHWTLPRLVGTAVAAEL-SAQRAVETGLANRCLPAGKVLGAALRMAHDIA....... 195
47 -9.370d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}  ali model 3D-neighbors follow..  12  12...........................................................................................ALESGIVELKFDLKGESVNKFNRLTLNELRQAVDIKADASVKGVIVSSGKGADITEDAELIAGNLEANKIFSDFEDLNVPTVAAINGIALGGG-LEMCLAADFRVMADSAKIGLGGTVRLPRLIGVDNAVEW-RAEDALKVSAVDAVVTADKLGAAALDLIK.......... 203
48 -9.260d1hnua_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  7...........................................................................................RIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGGADFKGIAKAQGDVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYGTTVSLPLKFGTNTTYEC-KYDIMCENGFISKNFNMPSSAKVLEELREKVKGLYLPS. 221
49 -9.150d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  11  14.................................................................................................VAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRGLDLTEPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGG-CLVALTCDYRILADNPRYCIGLNETLENTIGHRAAERA-PPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPD... 205
50 -9.110d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  16  15.................................................................................................VGLIRLDRPDALNALNQTLEAEVLDAADFDADLEIGAIVVTGSEGADIAE-TPHQARERNLLSGWDSLTQVRKPIVAAVAGYALGGG-CELAMLCDLVIAADTARFGQGGTQRLTRAVGKAKAMDL-TAEEAERVGLVSRIVPAADLLDEALAVAQRIARMS.... 201
51 -9.060d3oc7a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}  ali model 3D-neighbors follow..  13  12...........................................................................................ATGGPVARLTLNSPHNRNALSTALVSQLHQGLRDASSDPAVRVVVLAHTGGADLSEYDMAVERAREMAALMRAIVESRLPVIAAIDGHVRAGGF-GLVGACDIAVAGPRSSFALTSLTLLPKLSARALTGEKFDARRAEEIGLITMAAE-----DLDAAIDQLVTDVGRGSP 208

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.