current user: public

If you have questions about the server, please let us know.

Query: d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst IAEIYYERGTIVVKGDAHVPHAKFDSRSGTYRALAFRYRDIIEYFESNGIEFVDNAADPIPTPYFDAEISLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGRIKELKPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGLTATFELast
1 -87.800d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors  100  1IAEIYYERGTIVVKGDAHVPHAKFDSRSGTYRALAFRYRDIIEYFESNGIEFVDNAADPIPTPYFDAEISLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGRIKELKPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGLTATFE 206
2 -52.500d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  20  59...............................LLPFGLVGQIKKFCDNFGYKAWDEWLSKLEIYSGNKRIEPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLAENYEGKILIIVPTTALTTQMADDFVDYRHAMIKKIGGGASKDAPVVVGTWQTVVKQPKEWFSQFGMMMNDECHLATGKSISSIISGLNCMFKFGLSGSLR 263
3 -30.800d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  26  7...................................................................LIQPRIYQEVIYAKCKETNC-LIVLPTGLGKTLIAMMIAEYRGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVAKAWARAKVIVATPQTIENDLLA-LEDVSLIVFDEAHRAVGNAYVFIAREYKRQLVIGLTASP. 166
4 -27.200d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  17  2.................................................................................LKKGMTTVLDFHPGAGKTRRFLPQILRRRLRTLVLAPTRVVLSEMKEAFHGLVKFHTQAFSAHGSGREVIDAMCHATLTYREPTRVVNWEVIIMDEAHFLDPASWAAHRARANESATILMTATP. 137
5 -26.800d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  28  25.....................................................................ELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREGGKSLYVVPLRALAGEKYESFKKWIGLRIGISTGDYEGDCDIIVTTADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMRIGLSAT.. 181
6 -25.900d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  23  7...................................................................................SFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSVLDQAETAGARLVVLATATP. 136
7 -23.500d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  20  8.................................................................NIKANLRPYQIKGFSWMRFMNKICLADDMGLGKTLQTIAVFSDAKKPSLVICPL-SVLKNWEEELSKFAPHRFAVFHEDRSKIKDIILTTYAVLLRDTRLKEVEWKYIVIDEAQNIPQTKIFKAVKELKSKYRIALTGTP. 162
8 -22.200d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  20  38.....................................................................EPRAIQKMWAKRILRKESFAATAPTGVGKTLAMSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAIGYYHGRIPKREKIVITTTQFLSKHYREL-GHFDFIFVDDVDAIASKNVDKLLHLLARGCLMVSTAT.. 208
9 -21.200d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebrafish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  19  35.................................................IKADKEKLPVHVVVDPVLSKVLRPHQREGVKFLWDSYGCIMADEMGLGKTLQCITLIWTL-DKVIVVSPS-SLVRNWYNEVGKWLGGRVQPV-QGMRIPTPILIISYETFRLHAEVLHKKVGLVICDEGHRLSDNQTYLALNSMNAQRRVLISGTP. 230
10 -19.400d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  24  82....................................................................FKLTNAQKRAHQEIRND-NRLLQGDVGSGKTVVAQLAIYEAGFQTAFMVPTSILAIQHYRRTVESFSKHVALLIGATTPSEDVVIGTHALIQEDVHF--KNLGLVIIDEQHRFGVKQREALMNKGKMVDTLVMSATP. 241
11 -18.200d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  21  25.....................................................................QFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQA-NGVAAACLNSTQTRETGCRTGQIRLLYIAPERLMLDPVLLAVDEAHCISQAALGQLRQRFPTLPFMALTATAD 185
12 -16.800d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  21  16.....................................................................NFTEVQSKTIPLMLQGKNVVVRAKTGSGKTAAYAIPILELGMKSLVVTPTRELTRQVASHIRDIGRKVAEVYGGMPYKAQDIVVATLLDLWSKGVIDLSSFEIVIIDEADLMFEMGFIDDIKIINRKITGLFSAT.. 169
13 -16.700d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  17  5...............................................................................SMLKKKQLTVLDLHPGAGKTR--VREAIKKRLRTVILAPTRVVAAEMEEALRG-VRYMTTAVNVTHSGTEIVDLMCHATFTSRQPIRVPNYNLNIMDEAHFTDPSSYISTRVEMGEAAAIFMTATPP 143
14 -16.400d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  45.....................................................................LVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEAGLGVLIISPTRELAYQ-LRKVGKNHDFSAGLIIGGKDNNINILVCTLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVKKRQTLLFSAT.. 209
15 -16.200d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  36.....................................................................KPTKIQIEAIPLALQGRDIIGLAETGSGKTILNALLETPQRLFALVLTPTRELAFQISEQFEALIGVQSAVIVGGIAKKPHIIIATIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKIRDRKTFLFSAT.. 197
16 -15.600d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  49.....................................................................MPTPIQMQAIPVMLHGRELLASAPTGSGKTLMQLKQPANKGFRALIISPTRELASQIHRELIKISEGT-KKFGPKSSKKFDILVTTPNRLIYLLKQDPPGIDLLVVDESDKL-RDQLASIFLACTSHKVAMFSAT.. 217
17 -15.500d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  15  23.....................................................................KPTEIQERIIPGALRGESMVGQSQTGTGKTIMEKIKPERAEVQAVITAPTRELATQIYHETLKITGTDKQKALEKLNVQPHIVIGTINDFIREQALDVHTAHILVVDEADLMLDMGFITDVDQIKDLQMLVFSAT.. 187
18 -15.500d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  22  46............................................................QLFCDSFPFETTPDQAQAINAVLSDMCQLVCGDVGFGKTEVAMRAAFLAHKQVAVLVPTTLLAQQHYDNFRDRFKEQTQILAEVAEGKIDILIGTHKLLQSDVKF--KDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATP. 213
19 -15.500d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  24.....................................................................KPSPIQEESIPIALSGRDILARAKNGTGKSLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSGTNLRDDIMRLDDTVHVVIATILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIKNRQILLYSAT.. 185
20 -15.400d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  16  32.....................................................................EPSAIQQRAIMPIIEGHDVLAQAQSGTGKTALQRIDTSVKAPQALMLAPTRELALQIQKVVMALMDIKVHACIGGTSRDAQIVVGTVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIPTTQVVLLSAT.. 191
21 -15.000d2gk6a1 c.37.1.19 (A:295-324,A:416-702) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  86.....................................................................DLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREMNADVICCTCVGAGDPR---KMQFRSILIDESQATEPECMVPVVLGAKQLILVG...... 277
22 -15.000d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  23.....................................................................RPSPVQLKAIPLGRCGLDLIVQAKSGTGKTALDSLVLENLSTQILILAPTREIAVQIHSVITAIGGLECHVFIGGTPKKCHIAVGSIKQLIELDYLNPGSIRLFILDEADKL-QEQINWIYSSLASKQMLAVSAT.. 184
23 -14.900d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  20  23.....................................................................TPTPIEAAALPLALEGKDLIGQARTGTGKTLFALPIAERLAPRALVLTPTRELALQVASELTAVAGTGYGKQKEALLRGADAVVATALDYLRQGVLDLSRVEVAVLDEADEMLSMGFEEEVEALPSRQTLLFSAT.. 184
24 -14.800d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  23.....................................................................HPSEVQHECIPQAILGMDVLCQAKSGMGKTTLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSNVKVAVFFGGKKNCPHIVVGTILALARNKSLNLKHIKHFILDECDKM-RRDVQEIFRMTPHEKQVMMSAT.. 186
25 -14.600d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  24.....................................................................KPSKIQERALPLLLHNPPRNMISQSGTGKTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGK---DSFEKNKQINAQVIVGTVLDLMRRKLMQLQKIKIFVLDEADNM-GDQCIRVKRFLPKDTQLVLSAT.. 183
26 -14.400d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  41.....................................................................KPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGQRNGPGMLVLTPTRELALHVEAECSKYSYKGLKIYGGRNRNGQDIIIATLNDLQMNNSVNLRSITYLVIDEADKM-EPQIRKILLDVRPRQTVMTSAT.. 206
27 -14.300d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  17  71..............................................INPFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTFVLFDEMPHLENTQV-VAAMSVAQRVAEEMDVKLGEEVGRFENKTSNKTILKYMTDGMLLREEDHDLSRYSCIILDEAHERTLATLKQVVKRRPDLKIIIMSATLD 251
28 -13.800d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  35.....................................................................HPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVKREGPYGLIICPSRELARQTHGILEYYCGMSVKEQMETIRHGVHMMVATLMDLLQKKMVSLDICRYLALDEADRM-EGDIRTIFSYFKGRQTLLFSAT.. 209
29 -13.800d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  151........................................................................NWQKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALRCRIRLAAPTGKAAARLTESLGKALRQ---PLTDEQKKRIPEDASTLHRLLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRD 298
30 -13.400d4pj3a3 c.37.1.19 (A:416-492,A:662-1133) Pre-mRNA splicing factor Cwf11 / Aquarius {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  212...............................................................PKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIEQRTLIVTHSNQALNQLFEKIMAIDERHLLRLGHGEEELETEKDFSRYGRVNY............................................ 317
31 -13.400d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  35.....................................................................RPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPIRKQYPISLVLAPTRELAVQIYEEARKFSGADIGQQIRDLERGCHLLVATLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIGVRHTMMFSAT.. 217
32 -12.700d3jb9x3 c.37.1.19 (X:385-460,X:619-1044) Pre-mRNA splicing factor Cwf11 / Aquarius {Schizosaccharomyces pombe 972h- [TaxId: 284812]}  ali model 3D-neighbors follow..  17  183...................................................................LYTYNDKQLESILRGSQPGLTMVNGPTRCGKHVLVCKLLEVLNDRTVVLSDSNFSMNTLFTLLEKARCFHQGHLLYLSDEGKDETLERYGTLSSWISKLPG-----LLREIGRLAAS...................... 299
33 -11.100d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  15  15......................................................................VEKYRPQRLDDIVGQEH-LFAGPPGVGKTTAALALAREL--------------------FGENWRHNFLELNASDERGINVIREKVKEFARTKPIGGASFKIIFLDEADALTQDAQRRTMEMFSSNVRFILSCN.. 147
34 -11.000d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  16  8........................................................................................LLSGHPGSGKSTIAEALANLPGVPKVHF----------SDDLWGYIKH--GRIDPWLPQSHQQNRMIMQIAADVAGRYAKEGYFVILDGV--VRPDWLPAFTALARPLHYIVLRTTAA 112
35 -10.600d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  76...................................................................VTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVALTGKGVHVVTVNEYLASEQMGKIFEFLGLTVGLNLNSMSKDEDITYSTNNELLYKEQMVQRPLHFAVIDEVDSILID---------EARTPLIISGQXS 228
36 -9.770d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  14  1.....................................................................................ERGIIIVFTGNGKTTAAFGTAARAGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRLLDMVVLDELTYLPLEEVISALNARPGHQTVIITG... 134
37 -9.540d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  25...........................................................................ANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCRE-IEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPAR--GRFKVYLIDEVHMLSRHSFNALLKTLEPEHVKFLLATTD 154
38 -9.510d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}  ali model 3D-neighbors follow..  10  7........................................................................................ILNGGSSAGKSGIVRCLQSVLPEPWLAF--GVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLLWVGVRCDGA 124
39 -9.480d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  16  2......................................................................VDKYRPKSLNALSHNEE-LLYGPNGTGKKTRCMALLESIFGPGVYRLRKLELNVVSSPYHLEITPSDMGNNDR-QELLKEVAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKDALRRTMEKYSKNIRLIMVCD.. 169
40 -9.460d4lcba_ c.37.1.0 (A:) automated matches {Acidianus hospitalis [TaxId: 933801]}  ali model 3D-neighbors follow..  19  37......................................................................................RGILLYPPGNGKTMLAAAVANEID-SYFIHVDAASIMSKWLGEAEKN-------------------VAKIFNTAREYSKKDNKPAIIFVDEIDALLGTEMDGIMDKNENYMVYVIGAT.. 152
41 -9.250d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  17  4........................................................................................IITGEPGVGKTTLVKKIVERLGKRA-FRIITTEGKKKIFSSKFFTSKKLVGSYGVNVQYFEELAIPILERAYREAKK--DRRKVIIIDEIGKMESKKFRDLVRQIMHDPNVNVVAT.. 136
42 -9.230d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  17........................................................................PPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIPTGPVIYLPAEDPPTAIHHRLHALAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVI---LHHASKGAAMMGAGDQQQASR-GSSV... 200
43 -9.220d1vdza1 c.37.1.11 (A:60-113,A:191-439) A1 ATP synthase A subunit, central domain {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  14  84............................................................................DTFFPQAKGGTAAIPGPFGSGKTVTQHQLAKWSDAQVVIYIGCGERGNEMTDVLEEFPKLKDPKTGKPLMERTVLIANTSNMSIYTGITIAEYF-ALMADSTSRWAEALREISGRLEEMPGEEGYPAY.. 224
44 -9.080d2vhja_ c.37.1.11 (A:) automated matches {Pseudomonas phage [TaxId: 161736]}  ali model 3D-neighbors follow..  10  110.......................................................................SPVVAEFGGHRYASGMVIVTGKGNSGKTPLVHALGEALGGKKYATVRFGEPLSGYNTDFNVFVDDIARAM--------------------------LQHRVIVIDSL............................ 191
45 -9.050d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}  ali model 3D-neighbors follow..  12  44........................................................................................LLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETA-----------------------CQAMKKIFDDAYK--SQLSCVVVDDIERLSNLVLQALLVLLKK-LIIGTTSRKD 154
46 -9.020d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  13  21.......................................................................REQQLQQLDILLGNPRATLLGRPGTGKTVTLRKLWELYKDKT-FVYINGFIYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHLRERDLYM-----FLVLDDAFNLAPDILSTFIRLGQ............ 149

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.