current user: public
If you have questions about the server, please let us know.

Query: d2gboa1 a.23.6.1 (A:1-82) Hypothetical protein EF2458 {Enterococcus faecalis [TaxId: 1351]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MDEGISKKFAIQLLEDDAERIKMLIRNQKNSLCISQCKAFEEVVDTQMYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQLast
1 -61.100d2gboa1 a.23.6.1 (A:1-82) Hypothetical protein EF2458 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors  100  1MDEGISKKFAIQLLEDDAERIKMLIRNQKNSLCISQCKAFEEVVDTQMYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQ 82
2 -58.000d2odma_ a.23.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}  ali model 3D-neighbors follow..  35  1...ATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSK 79
3 -6.790d2igia_ c.55.3.5 (A:) Oligoribonuclease {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  9..........................................WIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPTIAVH 48
4 -5.680d4kb1a_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 83333]}  ali model 3D-neighbors follow..  17  14..........................................VIDVETAGFNAKTDALLEIAAITLKMDEQ........... 42
5 -5.390d3fiaa_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  45............................QSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKKLQGYQLPSALPPVMK. 98
6 -5.250d1jbia_ d.209.1.1 (A:) Cochlin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  9.................FTRGLDIRKEKADVLCPGGCPLEESVYGNIVYASVSSI--AVHRGVISNSGGPVRVYSLPGR... 72
7 -5.130d3brja1 a.285.1.1 (A:6-172) Mannitol operon repressor MtlR {Vibrio parahaemolyticus [TaxId: 670]}  ali model 3D-neighbors follow..  23  1...............NESEIIERLNSAPSVGFFIATVDVFNESIDGLI-DLSVRLKLLFGLGVLPDDIYHDIIIKLKNHLNS 95
8 -5.080d1k28a3 d.2.1.3 (A:130-345) Tail-associated lysozyme gp5, catalytic domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  14  105..GSITMEEATTLFERDLADMQRDIKS-----HSKVGPVWQAVNRSRQMAL---ENMAFQMGVGGVAKFNTMLTAMLAG... 173
9 -4.950d1fjgt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  21  42........................................AEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQ 83
10 -4.870d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  18  36...........................TKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVRKNGYDLPEKLPESL.. 89
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.