current user: public

If you have questions about the server, please let us know.

Query: d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst TYEGRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLDTLast
1 -102.000d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors  100  1TYEGRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLDT 248
2 -93.100d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  27  2......EPVRIERNGPVTTVIIDRPEARNAVNGPTAAALFAAFEEFDADDTASVAVLTGANGTFCAGADLKAFGTPEANQV-------HREGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVVDEDATMGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDLILTGRAVDAAEAYAIGLANRVVPTGQARQAAEELAADLARLPQQCMRADRLSALHQWGESENAAMDFEFASI........ 228
3 -90.700d3pe8a_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  25  2......PVLLVDTTDRVRTLTLNRPQSRNALSAELRSTFFRALSDAQNDDDVDVVIVTGADPVFCAGLDLKELGDTTEL--------------PDISPKWPDMTKPVIGAINGAAVTGGLELALYCDILIASENAKFADTHARVGLMPTWGLSVRLPQKVGVGLARRMSLTGDYLSAQDALRAGLVTEVVAHDDLLTAARRVAASIVGNNQKAVRALLDSYHRIDALQTGGALWAEAEAARQWMRST. 228
4 -90.000d3swxa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 36809]}  ali model 3D-neighbors follow..  24  1....DYETLRIRRDGYVLVIGLNRPAKRNAFDKTMLEELALALGEYETDTDLRAAVLYGEGPLFTAGLDLASVAAEIQGGA----SLTPEGGINPWQVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQLEVNRGIYPFGGATIRFPRTAGWGNAMRWMLTADTFDAVEAHRIGIVQEIVPVGEHVDTAIAIAQTIARQAPLGVQATLRNARLAVREGDAAAEEQLVPTVRELFTSE. 239
5 -89.800d5e0nx_ c.14.1.0 (X:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  25  1....TRFVLLDRSRPGVALVTLNRPERMNSMAFDVMVPLLELLGDLRHDNSVRVVILTGAGRGFSSGADHKSAGSVPHVDGRPTYALRSMEVLDNVILALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYFRAAGINNGLTASLGLSYLLPRAIGTSRAFEIMLTGRDVDAAEAERIGLVSRTVPDDDLLETCFEMAQRMRGFSRPGIELTKRTLWSGLDASLEGHMQAE............ 236
6 -89.400d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  27  1...TTYTTIATSRVAGVGLIRLDRPDALNALNQTLEAEVLDAARDFDADLEIGAIVVTGSERAFAAGADIAEMVTLTPHQA-------RERNLLSGWDSLTQVRKPIVAAVAGYALGGGCELAMLCDLVIAADTARFGQPEITLGILPGLGGTQRLTRAVGKAKAMDLCLTGRSLTAEEAERVGLVSRIVPAADLLDEALAVAQRIARMSRPAGRAVKDAINEAFERPLSAGMRYERDAFYAMFDTH. 238
7 -89.200d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}  ali model 3D-neighbors follow..  26  2.....YEAIGHRVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIPLDKGVAGVRDHFRIAALWWHQMIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCAWHTIGIGNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKERFHAGWMQPVEECTEFEIQNVIASVTHP. 243
8 -89.000d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  19  2...APVAGLDVTLSDGVFSVTINRPDSLNSLTVPVITGIADAMEYAATDPEVKVVRIGGAGRGFSSGAGISADDVSDGGGV---PPDEIILEINRLVRAIAALPHPVVAVVQGPAAGVGVSIALACDVVLASENAFFMLAFTKIGLMPDGGASALVAAAVGRIRAMQMALLPERLPAAEALAWGLVTAVYPADEFEAEVDKVIARLLSGPAVAFAKTKLAINAATLTELDPALQREFDGQDFVEGATA 250
9 -89.000d4f47a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  25  2......PDALVEQRGHTLIVTMNRPSRRNALSGEMMQIMVEAWDRVDNDPDIRCCILTGAGGYFCAGMDLKAATKKPPGDS--FKDGSYDPSRIDALLKGRRLKKPLIAAVEGPAIAGGTEILQGTDIRVAAESAKFGISEAKWSLYPMGGSAVRLVRQIPYTVACDLLLTGRHITAAEAKEMGLVGHVVPDGQALTKALEIAEIIAANGPLAVQAILRTIRETEGMHENEAFKIDTRIGIEVFLSD. 240
10 -88.700d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}  ali model 3D-neighbors follow..  25  1.......DVLFSNHGRVAVITLNRPERLNAWTTPMRETIIDALERFNRDPEVAAIIMTGAGRAFSAGQDLSEAHDFDGERA-----VAWVKEWQRYYTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRMGQPEINAGI-ASTTGPWIMNAMLGMSRTIELTLTGRLMEAEECHRIGLIHHLVDEDKVFDKALEIATELAAKPPVAMRLDKQRFREMTEPGFIDCIEAGERI......... 227
11 -88.500d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}  ali model 3D-neighbors follow..  21  1.....MDTLDFEVVNNVGWIRMNRAAKHNPFDAELRADLMTVLERVRDDADIRVLVLTSHPGSFCAGGNLHVLRDNLDSGPA--YWQQRIKTGLRFIHDMLNLGRPVIAAVDGPAFGAGFALSLTADIVLASPRARFSMAYLRLGLVPDLGALYLLPRAVGLQRAKELMFSTRELDAEEAHRLGLVMEVHESEALEQRAREIAESLVQAAPTALALTKAALNVSLDSDEQTMFSLEAASQAAAFSTK. 240
12 -88.100d3peaa_ c.14.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}  ali model 3D-neighbors follow..  24  2.....LKFLSVRVEDHIAVATLNHAPA-NAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFSAGADIKEFTSVTEAK----QATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSE. 238
13 -88.000d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  22  2........VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGARSFSAGGDFNEVKQLSRSE----DIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKRAVNKPFIHLLEQTRDASKAVHK....... 230
14 -87.900d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  25  4....RTGRISVAIADGVASVEISNLAQRNALTKDMCLEIQELMPQLDADPDVAVVVLRGAGDTFCAGASISELASVLLDPQ---PDGSTADHLSRADSAIAALSKPAVALVDGACMGGGWQIASACDFIIANERAVIGLTPAKIGIIYPRPGLERLVRLVGHANAKYILLTGQTFSAPEARALGLVADVVPSESFEEKCAALVRSLRSRSRFSMHSMKRLVDLTDSVPAAGIDQEWAAAWDMGIGISA 251
15 -87.700d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  25  1......ADIDFRIEGHVAHVRLNRPQGLNAITQEMDDLLLDAWTEVNANSDIWAVVLSAEGKAFCIGADVSGGAERKTRMA-------LGGGLTGIGGPLVTCKKPMVAAVQGFCVGGGFELAMCADIIVAADTAQFGLPETKVGIIGECGVVHRAMRQLPYHIALQLILTGERIKADEARHYGLVNEVVPFAELEEAALRWASKLNAASPLAVQAAKAAALGRLGHPLEVALMTRFEPIEEYAATE. 235
16 -87.400d3gowa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  26  2........VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDRKPDY------EAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQ. 234
17 -87.400d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  24  2.......AIKSTSEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENNPEIRSVVITGEGAVFCAGGNLQRLQANRREAPE--VQAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMSYSTVGLSPDGGGSWSLARSLPRALASELLMGGERISAQRLHDLGLVNKVASAGDALSEALRMAGQLNARAPNALASIKELINEASSNTLSQQLACERDHFNGGEGIAA 247
18 -87.300d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  25  1.....MPEFKVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGKAFCAGADLKERATMAEDEV-----RAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTE. 238
19 -87.000d3rrva_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  21  4.....PTEIDVRADGALRIITLNRPDSLNSVNDDLHVGLARLWQRLTDDPTARAAVITGAGRAFSAGGDFGYLKELSADAD---LRAKTIRDGREIVLGMARCRIPVVAAVNGPAVGLGCSLVALSDIVYIAENAYLADPHVQVGLVAADGGPLTWPLHISLLLAKEYALTGTRISAQRAVELGLANHVAD--DPVAEAIACAKKILELPQQAVESTKRVLNIHLERAVLASLDYALSAESQSFVTE. 240
20 -86.800d3tlfa_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  25  1...DSFDTIKYEVDGHTATITLNRPDALNALSPHMITELRAAYHEAENDDRVWLLVVTGTGRAFCSGADVKEIPEDGKVIYERLSTYDQWEAPQEGTPPFRTMAKPVLTAVNGICCGAGMDWVTTTDIVIASEQATFFDPHVSIGLVAG-RELVRVSRVLPRSIALRMALMGERMSAQRAYELGLISEIVEHDRLLERAHEIADIVNSNAPLAVRGTRLAILKGLNVPLHEAEILAETFRERVLRTE. 247
21 -86.400d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  25  2PNMNFHDRVSVTIEDHVAHVLLDRADKMNALDDAMFEGIVAAGHHLHSVKGVRCVVLSGAGRSFCAGLDLSSMGRTDRWSGNSLTEHGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVMEVKWGLVPDMAGYALWRGNVRDDVLRELTYTHREFSGEEAVRFGFATHVAD--DPLAGAMELARVVAEKSPNAVRGAKTLSNRAPDLTVDDVLMAESIAQHELMYSR. 248
22 -85.700d3myba_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  22  1....EPLLLQDRDERGVVTLTLNRPQAFNALSEAMLAALGEAFGTLAEDESVRAVVLAASGKAFCAGHDLKEMRAEPSRE----YYEKLFARCTDVMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVSGINVGLFCSTPGVA-LSRNVGRKAAFEMLVTGEFVSADDAKGLGLVNRVVAPKALDDEIEAMVSKIVAKPRAAVAMGKALFYRQIETDIESAYADAGTTMSALEGVSA 246
23 -85.700d3qxza1 c.14.1.0 (A:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}  ali model 3D-neighbors follow..  23  1......TELHEEIRDGVAVLTLHGPSTRNSFTVELGRQLGAAYQRLDDDPAVRVIVLTGAPPAFCSGAQISAAAETFAAP------RNPDFSASPVQPAAFELRTPVIAAVNGHAIGIGMTLALHADIRILAEEGRYAIPQVRFGVAPDALAHWTLPRLVGTAVAAELLLTGASFSAQRAVETGLANRCLPAGKVLGAALRMAHDIATNAPESAALTKRLLWDAQMTGMSAAEVAARESQDAAEGPRA 246
24 -85.700d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  23  3........VEIERRGDASLIVLSRPEKLNAINLEMLADLADQFSKAEKE-DTRVIVITGYGKNFSAGADINMLASFDPASA-----YSFRLKMNSIAQRIRKSDKPVIALLKGYSMGGGLELAESADIRIAMSDAVIGQPESSIGINAGAGGNVILPKLVGRGSAAYLAMSGKKLNAQEAMALGLVDEVVDDEA---KAWKIIDDICKKPKKTLQFIKRAINSSYDMGLESAMDQEALYFSLLFTDP. 232
25 -85.600d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  2....SYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGKVFSAGHDIHELPSGGRDPLS------YDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERDSEDYQEGMNA 249
26 -85.600d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  23  2.....SDVIQLVREGAIATVTLNRPDRMNALNLPMWRGLAEAFETISADRSIHVVILRGAGKAFAPGADIEEFDTLRANAE---QAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGLELACCCDIRLSAKSGKFGVPINKISVVMAYPELAQIRRVAGPAAALEILLEGRIMDADEAAAKRLVNRVVEDDAMDAEVAATAKRIAAGAPLANRWHKAFIARLDDPTPVSEAELDEDTKDYAEGLAA 247
27 -85.300d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  23  1.....HPHLNANLEGGVLTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEHDFTAGNDMKDFMGFVQNPN---AGPAGQVPPFVLLKSAARLSKPLIIAVKGVAIGIGVTILLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVE--DAYATAQATAQHLTALPLASLKQTKALMKHDLD-QIIECIDHEAEIFMQRVQSP. 236
28 -85.300d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  22  5....GYSNLDLDLDNGVCVVTLNRPDKRNALDVATIEELVTFFSTAH-RKGVRAVVLTGAGDHFCAGLDLVEHWKADRSADDFMH---VCLRWHEAFNKMEYGGVPIIAALRGAVVGGGLELASAAHLRVMDQSTYFALPEGQRGIFTGGGATIRVSDMIGKYRMIDMILTGRVYQGQEAADLGLAQYITEGSSF-DKAMELADKIASNLPLTNFAICSAISHMQNMSGLDAAYAEAFVGGIVNTQP. 243
29 -85.100d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  27  2......ELVLSHVEGGVQVVRMNRPDKKNALIGEMYAALAEAFAKGEADDDVNVFLILGSQTDFSAGNDLPDFLTWEALSG---------SVADRFIRAVAGARKPVVAAVRGAAIGIGSTLLPHCDLVYAAPGTRFHMPFINLGIVPEAGSSQTMPALAGHRRAAEMLMLGEPFGVDTAEAVGLINGVVPGEDLEETAMAAARKLAAKPRSILVQIKALMKTPAE-PIMDRLTREAAVFDTCLKGE. 232
30 -84.600d3oc7a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}  ali model 3D-neighbors follow..  23  2.DALVDYAGPAATGGPVARLTLNSPHNRNALSTALVSQLHQGLRDASSDPAVRVVVLAHTGGTFCAGADLSEAGSGGSPSSAYDMAVERAREMAALMRAIVESRLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSFALTEARIGVAPAIISLTLLPK-LSARAAARYYLTGEKFDARRAEEIGLITMAAE--DLDAAIDQLVTDVGRGSPQGLAASKALTTAAVLERFDRDAERLAEESARLFVSD. 244
31 -84.100d4k29a_ c.14.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  27  1....TYSKILYETLHGVARITLNRPERTNALDQEMLGEINAAMDAAEADAGVKAVIVRGAGNAFSSGFDLKAQMEARPAGVD--AWRPLLRKDFDTVMRFWHCPKPTIAAVRGPCLAGACELALACDMTIATEDAFFGEPELKFG---AGIVVMLLPWIVGPKIAKEIILLGERVPARRAAEIGMVNRVVDGDGLDAEALRIARHIGAIDPGLVKETKRALNRALETQ.................... 220
32 -84.000d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  26  1......SDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGKHFSAGADLTWMQSMANFTEE--ENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLGLIPA-VISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLEFTLKYASQISNNAPEAVKNSKQLAQYVANKKIDEELAHKRVSDEGQEGLKA 247
33 -83.800d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  2.....FETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSII-TVLTGNGDYYSSGNDLTNFTDIPPGGVEE-KAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSD. 241
34 -83.600d2ppya_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}  ali model 3D-neighbors follow..  24  2AVETKKQYLTVFKEDGIAEIHLHINK-SNSYDLEFYKEFNAAIDDIRFDPDIKVVIVMSDVKFFSAGADINFLRSADPRFK-----TQFCLFCNETLDKIARSPQVYIACLEGHTVGGGLEMALACDLRFMGDEAKIGLPEVSLGVLAGTGGTQRLARLIGYSRALDMNITGETITPQEALEIGLVNRVFPQAETRERTREYARKLANSATYAVSNIKLAIMNGKEMPLNVAIRYEGELQNLLFRSE. 244
35 -83.500d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  21  2......LPIRLDIAAPLAEIVLNKPERRNALSVDMWAAIPGLVAEANANPDVKLILIHGGDGAFAAGADISEFETIYATEDAA---KASGQRIAQALDAIENSEKPVIAAIEGACVGGGVSLAMAADLRVAGEGAKFGVTPGKLGLVYPAGDTRRLLAAVGPGATKDILFTGRIFTAGEAKSLGLIDRLVEKGTALEAARVWAGEIAAISQWSVRATKRMIR-GLQTGWTDETPEAQSLFLNGFANE. 239
36 -83.200d2q35a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}  ali model 3D-neighbors follow..  18  3........QLTELGNGVVQITMKDESSRNGFSPSIVEGLRHCFSVVAQNQQYKVVILTGYGNYFSSGASKEFLIRKTRGEVEVLD----------LSGLILDCEIPIIAAMQGHSFGGGLLLGLYADFVVFSQESVYATNFMKYGFTPVGATSLILREKLGSELAQEMIYTGENYRGKELAERGIPFPVVSRQDVLNYAQQLGQKIAKSPRLSLVALKQHLSADIKAKFPEAIKKELEIHQVTFNQP. 231
37 -82.900d4k3wa_ c.14.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}  ali model 3D-neighbors follow..  21  1.....CETLILEKQGPTLVITINRPDVRNAMSLQMVAELSTIFSEIENDISIRAAVLRGAGGHFCAGGDIKDMAGARSQKAGEGRDYKLNRAFGQMIQQVNESSKVVIAITEGAVMGGGFGLACVSDLAIAGPTAKFGMPETTLGVIPAQIAPFVVER-IGLTQARRLALLGLRIDATEACKLGIVHQVAESEELSDMLNQALERVRLCAPDATAETKALLHRVGHEAMAGLLDDAAEKFAAAIRGP. 245
38 -82.700d4qiia_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  26  18.DDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGWAFCSGGDQRIRGRSGYQYASGDTARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASEYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLL-DDGLVGQQLFAGEATEAVEGRDA 284
39 -82.500d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  23  1....AYESIQVSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGDDVARDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFPKDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQ. 252
40 -82.300d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1....RYRDIVVRKQDGFTHILLSKSSENNSLNPEVMREVQSALSTAAAD-DSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKR-ESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANERECEVLKKIWGSA. 242
41 -81.900d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  19  3SLEARYPGLAFAWRPGVLEITF-RGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGVFSAGGSFGLIEEMRASHEALLR---VFWEARDLVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKHALNHWYRSFLP-HFELSLALEELEEGLKA 253
42 -81.400d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  25  2.......SLRLERDGAVARLLIDRADRRNAFSLDMWQRLPELLAEASGDDALRVLVVKSANGAFCAGADIAELLANKDDAA---FHAANQQAINRAQYELARFRLPTVAMVEGDCIGGGCGIALACDMRIAAPAARFGITPAKLGLVYPLHDVKLLVDLVGPGQARRLMFTGGLIDANEAHRIGLVELLGESEDA------LVGQLATVSSFSTQAIKSFVRRVLDGQVADDADSLREGADFREGTGA 240
43 -81.000d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  22  2........IGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAG-DGSARAIVLTGQGTAFCAGADLSGDAFAAD----------YPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLAD----AQAWAAEIARLAPLAIQHAKRVLNDD--GAIEEAWPAHKELFDKAWGSQ. 223
44 -80.400d2j5ga_ c.14.1.0 (A:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}  ali model 3D-neighbors follow..  20  7....KYENLHFHRENGILEVRMHTNGSSLVFTGKTHREFPDAFYDISRDRDNRVVILTGSGDAWMAEIDFPSLGDVTNPR----EWDKTYWEGKKVLQNLLDIEVPVISAVNGAALLHS-EYILTTDIILASENTVFDMPHLNAGIVPGDGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVALTQRLKRLVNEGIGYGLALEGITATDL. 246
45 -80.000d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  20  9...TQRPLSQDGTTQGGTVATLTLAAKMGSMGPAFWQEFPQALSE---LGDARVLIVRGE-QVFSAGLDVKSNGAAIVPALGKPDAKAVVDEMHAVTEGLAALPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLPEVKLGITADLGGLQRLPHLIGRGRTAHLALTGEAIDAATAERWGLVTEVLPDDALFARAEALAEHLAALPAKALEGTKRALSDGLP--HAESLAAAVRWNAEHMTVE. 248
46 -79.400d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  22  1....TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCE-TSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGR---KQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPA-CVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVL--LRKHLLRLRRLNKKGIAHYKQFMS-SLDHQVSRAKATALTANQDMFSDP. 235
47 -77.800d3h0ua1 c.14.1.0 (A:8-283) automated matches {Streptomyces avermitilis [TaxId: 33903]}  ali model 3D-neighbors follow..  21  1..TASYETIKARLDGTVLSATFNAPP-MNLIGPEVVRDLVALLEELAHPTAPRVVIFDSADDFFFPHVDMTKVPEYTAEAAK--AGGPGDASLGMLFRKLSQLPAVTIAKLRGRARGAGSEFLLACDMRFASENAILGQPEVGIGAPPGAGAIQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKSAIN-AISLPAPAEVRADAALFQQLVRGE. 243
48 -77.400d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1...SQRVLVEPDAGAGVAVMKFKNPPV-NSLSLEFLTELVISLEKLENDKSFRGVILTSDRGVFSAGLDLTEMCGRSPAHY-----AGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKD. 241
49 -76.800d1hnua_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  2......EKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKAQGDDTNKYPSSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSNDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDG. 255
50 -66.500d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}  ali model 3D-neighbors follow..  17  4....EGKAITVTAESGIVELKFDLKESVNKFNRLTLNELRQAVDAIKADASVKGVIVSSGKDVFIVGADITEFVENFKLPDA--ELIAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDLIKRAISGEL-APVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSA 286
51 -11.800d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  13  85...........TILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSG-----GARIQEGIDSLSGYGKMFFANVKLSGV------------PQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFI-----------TGPQVIKSVTGEDVTADEL------AEAHMAISGNIHFVAEDDD---AAELIAKKLLSFLP..................................... 250
52 -11.200d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  10  100...........RVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCS-----GVEFPN-------QDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGI----SGMNPKGYIDDEAAEQIIAAQIENSKLKVPAYDETGFFREVYQNDL---GVIDGIKKYISYLP..................................... 288
53 -10.600d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  98................VVAAAFEFAFMGGSMGSVVGARFVRAVE-QALEDNCPLICFSASG-----GARMQE----------ALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVASFAMLGDLNIAEPKALIGF-----------AGPRVIEQTVREKLPPGF-------RSEFLIEKGAIDMIVRRPEMLASILAKLMNLPAPNP..................................... 263
54 -9.090d2f6ia1 c.14.1.1 (A:179-366) Clp protease, ClpP subunit {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}  ali model 3D-neighbors follow..  23............................DEINKKTADELISQLLYLDNINHNDIIYINSPGGSINEGLAI--------------------------LDIFNYIKSDIQTISFGLVASMASVILASGK-RKSLPNCRIMIHQPLGNAFGHPQDIEIQTKEILYLKKLLYHYLSSFMNALEAKQYGIIDEVIETKLPHPY.................................................. 186

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.