current user: public
If you have questions about the server, please let us know.

Query: d2l93a1 a.155.1.1 (A:91-137) automated matches {Salmonella typhimurium [TaxId: 90371]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst AARPAKYSYVDENGETKTWTGQGRTPAVIKKAMEEQGKQLEDFLIKELast
1 -35.800d2l93a1 a.155.1.1 (A:91-137) automated matches {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors  100  1AARPAKYSYVDENGETKTWTGQGRTPAVIKKAMEEQGKQLEDFLIKE 47
2 -6.080d3cfib_ d.24.1.5 (B:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}  ali model 3D-neighbors follow..  15  118.....NVRFYDGKQWINEWSNELTLPAAISVELTLKD.......... 149
3 -6.060d3ci0j1 d.24.1.5 (J:39-192) Pseudopilin GspJ {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  9  109.....RLQFYDGTRWQESWSSVQAIPVAVRMTLHSPQ.......... 140
4 -5.830d2yc2a_ b.18.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}  ali model 3D-neighbors follow..  12  30...........DGKDNTFWVTTGMFPQEFVLRLESC-IRVSKITT.. 62
5 -5.610d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  29...........DGNPETFWTTTGMFPQEFIICFHKH-VRIERLVI.. 61
6 -5.360d1d2oa1 b.3.5.1 (A:535-624) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  15  8...............EKVWDDKGKRPEKVSVNLLANGEKVKTLDVTS 43
7 -5.330d2ei9a_ d.151.1.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}  ali model 3D-neighbors follow..  19  122..........DTNAHSPLWHSLPRHYVGRGQEVADRRAKMEDFIGA. 157
8 -4.950d3ag3g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  12  45.PAFIPYHHLRIRTKPFSW-GDGNHTFFHNPRVNPLPTGYEK..... 84
9 -4.810d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  24  9.................TGNGKGKTTAAFGTAARAVGHGKNVGVVQ. 37
10 -4.530d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  19  14...................PGAGKTRRFLPQILAECARRRLRTLV.. 39
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.