current user: public
If you have questions about the server, please let us know.

Query: d2odci2 a.140.1.1 (I:2-47) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst DNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLast
1 -31.600d2odci2 a.140.1.1 (I:2-47) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1DNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRR 46
2 -27.700d1h9fa_ a.140.1.1 (A:) Thymopoietin, LAP2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  35  9.DVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTE 53
3 -5.970d1h9ea_ a.140.1.1 (A:) Thymopoietin, LAP2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  5EDPSVLTKDKLKSELVANNVT--PAGEQRKDVYVQLYLQHLTARNR 49
4 -5.130d4doia_ d.36.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  13  170TGIAVIENKLLAEAVLESIIGKNGVSPGTRLSVAERLSQLMMKNK. 214
5 -4.690d1bh9a_ a.22.1.3 (A:) TAF(II)18 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1.....LFSKELRCMMYGFGDDQNPYTESVDDLVIEFITEMTHKAMS 44
6 -4.630d4uzwa1 a.140.2.1 (A:2-50) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  20  2.DYSSLTVVQLKDLLTKRNLS----VGGLKNELVQRLIKDDEESK. 41
7 -4.420d1v74a_ d.243.1.1 (A:) Colicin D nuclease domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  9....RFSRKQLDKKYKDFGISDTKKNRETLTKFRDAIEEHLSDKDT 53
8 -4.230d1r1ga_ g.3.7.2 (A:) Neurotoxin bmk37 {Chinese scorpion (Buthus martensi karsch) [TaxId: 34649]}  ali model 3D-neighbors follow..  11  5.......SSDCRVKCVAMGFSSGKCINSKCKCYK............ 31
9 -3.980d4hs1a1 c.47.1.1 (A:2-79) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  13  28QKVDISLDSEARDYVMALGYLQAPVVVAGNDHWPDRIKALAGAALT 77
10 -3.950d1zrja1 a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucleoprotein U-like protein 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  2.DVRRLKVNELREELQRRGLD----TRGLKAELAERLQAAL..... 37
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.