current user: public

If you have questions about the server, please let us know.

Query: d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst MKVEELAESISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEKYESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMRRMNKALRVIGLSATAPNVTEIAEWLDADYYVSDWRLast
1 -99.800d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors  100  1MKVEELAESISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEKYESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMRRMNKALRVIGLSATAPNVTEIAEWLDADYYVSDWR 202
2 -35.500d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  21  113........................EPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLARYYLENEGKILIIVPTTALTTQMADDFVDYRLFHAMIKKIGGGASKDDKYKNDAPVVVGTWQ---TVVKQPKEWFSQFGMMMNDECHLA----TGKSISSIISGL---NNCMFKFGLSGSLRDGKA............... 267
3 -32.500d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  7........LLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLNLSTQILILAPTREIAVQIHSVITAIGIKGLECHVFIGPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKL---EEGSFQEQINWIYSSLPASKQMLAVSATYPE.................. 187
4 -31.700d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  24  12...........................IYQEVIYAKCKE-TNCLIVLPTGLGKTLIAMMIAEYRLTKGGKVLMLAPTKPLVLQHAESFRRLFNLPPKIVALTGEKSPESKAWARAKVIVATPQTIENDLLAGRISLEDVSLIVFDEAH---RAVGNYAYVFIAREYKRQAKNPLVIGLTASPGSTPEKIMEVINNL...... 180
5 -29.700d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  21  16........ELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIVKAPQALMLAPTRELALQIQKVVMALAFMDIKVHACIGSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLL---PPTTQVVLLSATMPN.................. 194
6 -29.200d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  33........KINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKKGFRALIISPTRELASQIHRELIKISETGFRIHMIHKAAVAAKK--KKFDILVTTPNRLIYLLKQDPPGLASVEWLVVDESKLFEDGKTGFRDQLASIFLACTSHKVRRAMFSATFAY.................. 220
7 -28.800d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  19  1.........MNEKIEQAIREMGFKNFTEVQSKTIPLMLQGKNVVVRAKTGSGKTAAYAIPILE---LGMKSLVVTPTRELTRQVASHIRDIGRMDTKVAEVYGPYKAQINRVRNADIVVATPGRLLDLWSKGVIDLSSFEIVIIDEADLMFEMGFIDDIKIILAQT---SNRKITGLFSATIPE.................. 172
8 -28.400d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  18  7........PFQPFIIEAIKTLRFYKPTEIQERIIPGALRGESMVGQSQTGTGKTHAYLLPIMEKIKPERQAVITAPTRELATQIYHETLKITKFMIVARCLIGGTDKQKA--VQPHIVIGTPGRINDFIREQALDVHTAHILVVDEADLMLDMGFITDVDQIAARM---PKDLQMLVFSATIPE.................. 190
9 -28.200d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  20........GVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQALVLTPTRELAFQISEQFEALGSIGVQSAVIVGGIDSMSQSLKKPHIIIATPGRLDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVI---PRDRKTFLFSATMTK.................. 200
10 -28.100d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  8........CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLKDNIQAMVIVPTRELALQVSQICIQVSK-GAKVMATTGGTNLRDD--DTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTL---PKNRQILLYSATFPL.................. 188
11 -28.000d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  14  8........GLAPELLKGIYAMKFQKPSKIQERALPLLLHNRNMIAQSQSGTGKTAAFSLTMLTRVDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNM---DQQGLGDQCIRVKRFLPKDTQLVLFSATFAD.................. 186
12 -27.800d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  25........QQYPDLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPIMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQ--KGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVR---PDRQTVMTSATWPTVRQLAL............ 216
13 -27.700d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  7........LLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLTGQVSVLVMCHTRELAFQISKEYERFSKYNVKVAVFFGGLSIKKDKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECKMLEQLDMRRDVQEIFRMT---PHEKQVMMFSATLSK.................. 189
14 -27.400d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  29........PLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQGVLIISPTRELAYQTFEVLRKVGKHDFSAGLIIGDLKHEAERINNINILVCTPGRLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENL---PKKRQTLLFSATQTK.................. 212
15 -27.300d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  20  1MEFKDF--PLKPEILEALHGRGLTTPTPIEAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLAPSQRALVLTPTRELALQVASELTAVAP-HLKVVAVYGGTGYGKQK-RGADAVVATPGRALDYLRQGVLDLSRVEVAVLDEADEMLSMGFEEEVEALLSAT---PPSRQTLLFSATLPS.................. 187
16 -26.900d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  31.................FFRKCVGEPRAIQKMWAKRILRKESFAATAPTGVGKTSFGLAMSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEAGVGTENLIGEKENFMQNLRNFKIVITTTQF----LSKHYRELGHFDFIFVDDVDAILKASKN--VDKLLHLLWVGEARGCLMVSTATAKK.................. 211
17 -26.800d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  28  70........................SLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINEL---STPTLIVVPTLALAEQWKERLGIF--GEEYVGEFSGRIK------ELKPLTVST---YDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFR--------LGLTAT..................... 204
18 -26.700d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  19........EMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPSLVLAPTRELAVQIYEEARKFSRSRVRPCVVYGGADIGQQI-RGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPKGVRHTMMFSATFPEIQMLAR............ 227
19 -25.500d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  19........KFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKGLIICPSRELARQTHGILEYYCRLLLRCALCIGGMSVKEQM-HGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFK---GQRQTLLFSATMPKIQNFAK............ 219
20 -25.100d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  22.....................GYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPAL---LLNGLTVVVSPLISLMKDQVDQLQA---NGVAAACLNSTQTREQQL-GQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYALGQLRQRFPTLPFMALTATADDRQDIVRLLGLN....... 199
21 -21.600d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  18  2....................................LKKGMTTVLDFHPGAGKTRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFHG-LDVKFHTQAFSAHGS------GREVIDAMCHATLTYRMLEPTR-VVNWEVIIMDEAHFLDPAS---IAARGWAAHRARANESATILMTATPP................... 138
22 -21.400d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  20  83........................KLTNAQKRAHQEIRND-NRLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTVEFSKFNIHVALLIGATTPSEKE-GQIDVVIGTHALIQEDVH-----FKNLGLVIIDEQHRFGVKQR--------EALMNKGKMVDTLVMSATIPRSMALAFYGDLDV...... 256
23 -18.600d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  22  7......................................SFQVAHLHAPTGSGKSTKVPAAYAA---QGYKVLVLNPSVAATLGFGAYMSK--AHGVDPNIRTGVRTI----TTGSPITYSTY---GKFLADGGCSGGAYDIIICDECHSTDATS---LGIGTVLDQAETAGARLVVLATAT..................... 135
24 -16.500d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  22  60.............................QAQAINAVLSD-DRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFDRFANWPVRIEMISRFRSAKEQT-GKIDILIGTHKLLQSDVK-----FKDLGLLIVDEEHRFGVRHK--------ERIKAMRANVDILTLTAT..................... 212
25 -15.700d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  18  5..................................SMLKKKQLTVLDLHPGAGKTRRVLPEIVREIKKRLRTVILAPTRVVAAEMEEALRG-------LPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIR-VPNYNLNIMDEAHFTDPS---SIAARGYISTRVEMGEAAAIFMTATPPG.................. 144
26 -13.800d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  16  95.........................VHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDHLENTQVACTQPRRVAAMSVAQRVA--EEMDVKLGEEVGSIRFENKTSNKTILKYMT----DGMLLREDHDLSRYSCIILDEAH-----ERTLATDILMGLLKQVRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGR 270
27 -13.300d2gk6a1 c.37.1.19 (A:295-324,A:416-702) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  85.......................PDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQL--TEKIHQTGLKVVRLCAKSTAERELLMNADVICCTCVGAGDPRLAK----MQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQ---LGPVVMCKKAAKAGLSQSLFE.... 302
28 -12.200d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebrafish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  17  54.......................KVLRPHQREGVKFLWDSYGCIMADEMGLGKTLQCITLIWTLLKQSDKVIVVSPSSLVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVNFPILIISYETFRLHAEVLHK--GKVGLVICDEGHRLKNSD-----NQTYLALNSMNAQRRVLISGTPIQNYFSLVHFVNSGILGT... 252
29 -11.300d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  19  16.................YQIKGFSWMRFMNKLGFGICLADD-------MGLGKTLIAVFSDAKKENELTPSLVICPL-SVLKNWEEELSKFAP-HLRFAVFHEDRS--KIKLEDYDIILTT---YAVLLRDTRLKEVEWKYIVIDEAQNIKNPQ-----TKIFKAVKELKSKYRIALTGTPIEN.................. 165
30 -11.300d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}  ali model 3D-neighbors follow..  13  22...................................GFFKDSIILATGATGTGKTLLVSRFVENACANKERAILF----AYEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPESAGL------EDHLQIIKSEINDFKRIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTN..................... 159
31 -10.900d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  22  79.........................MFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLASRDAEQMGKFEFLGLTVGLNLNSMSKEKREAYAADITYSTNNELDNMVLYKEQMVRPLHFAVIDEVDILIDEARTPLI........................................... 222
32 -9.740d1cr1a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  13  3...ERIREHLSSEESVGLLFSGCTGIN----DKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLDVIILDHISIVGESDERKMIDNLMTKLKGFAKSTGVLVVICHLKNPDK............... 201
33 -9.490d2vhja_ c.37.1.11 (A:) automated matches {Pseudomonas phage [TaxId: 161736]}  ali model 3D-neighbors follow..  11  122......................................ASGMVIVTGKGNSGKTPLV-HALGEALGGKDKYATV--------------------------------------RFGEPLSGYNTDFNVFVDDIARAMLQHRVIVIDSLKNVIGAAGGNGAFDLLSDIGAMAASRGCVVIASL..................... 233
34 -9.380d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}  ali model 3D-neighbors follow..  21  41........................................VSVLLEGPPHSGKTALA--------------------AKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFD------------------DAYKSQLSCVVVDDIERLGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTI. 169
35 -9.310d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  17...........................PPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGPTGPVIYLP-----AEDPPTAIHH------RLHALGAHLSAEERQAVADGLLIQPLIG-PEWFDGLKRAAEGRRLMVLDTLRRFEEENASGPMAQVIGRMEAIAADTGCSIV........................ 174

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.