current user: public
If you have questions about the server, please let us know.

Query: d2pspa1 g.16.1.1 (A:1-53) Pancreatic spasmolytic polypeptide {Pig (Sus scrofa) [TaxId: 9823]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst EKPAACRCSRQDPKNRVNCGFPGITSDQCFTSGCCFDSQVPGVPWCFKPLPAQLast
1 -33.400d2pspa1 g.16.1.1 (A:1-53) Pancreatic spasmolytic polypeptide {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors  100  1EKPAACRCSRQDPKNRVNCGFPGITSDQCFTSGCCFDSQVPGVPWCFKPLPAQ 53
2 -28.500d2pspa2 g.16.1.1 (A:54-106) Pancreatic spasmolytic polypeptide {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  36  1....ESEECVMQVSARKNCGYPGISPEDCAARNCCFSDTIPEVPWCFFPMSVE 49
3 -18.000d2qmja1 b.30.5.11 (A:7-269) N-terminal subunit of Maltase-glucoamylase (NtMGAM), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  1..........VNELERINCIPDPPTKATCDQRGCCWNPQGVSVPWCYYSKNH. 44
4 -5.430d1l6pa_ b.1.17.1 (A:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  28  95.......................VTYQGCADAGFCYPPETKTVP......... 115
5 -5.420d2k9fb1 b.1.17.1 (B:2-128) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Neisseria meningitidis [TaxId: 491]}  ali model 3D-neighbors follow..  14  96.......................LTYQGSAEAGVCYPPVDTEFD......... 116
6 -5.380d1iarb1 b.1.2.1 (B:1-96) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  9  1..........FKVLQEPTCVSDYMSISTCEAHTCIPENNGGAGCVCHLLMDD. 67
7 -4.840d2k4ra_ g.14.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  26  43..............................PHNFCRSPDGAGRPWCFYRNAQG 65
8 -4.550d1n5ua3 a.126.1.1 (A:389-584) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  47.....SKCCKHPEAKRMPCAEDYLSNQLCVLHECCTESLVNRRP-CFSALEVD 106
9 -4.500d1bgca_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  9  39ELMLLRHSLGIPQAPLSSCSSQSLQLRGCLNQ..................... 70
10 -4.490d1n26a2 b.1.2.1 (A:94-195) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  7  2...........PEEPQLSC----FRKSPLSNVVCEWGPRSTPSLTTKAVLLVR 39
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.