Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: d2q4qa2 c.103.1.1 (A:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst TSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTCLast
1 -65.900d2q4qa2 c.103.1.1 (A:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1TSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC 121
2 -48.900d2cyja1 c.103.1.1 (A:1-118) Hypothetical protein PH1505 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  16  2...KIEEVRFGLVKIDGKEFDHDIVIYPSGRIERREISKKKHGTSHKLDPEELEKYLVEDFDVLLVGTGIYGMLSLLPESKKLVE--DKEVIEKPTKEALKLLEELWGKKR-ILAIIHVTC 118
3 -45.500d2fi9a1 c.103.1.1 (A:11-128) Hypothetical outer membrane protein BH05650 {Bartonella henselae [TaxId: 38323]}  ali model 3D-neighbors follow..  17  4GRAPIDAYGNGGFRFADMSHRGS-IICIPSGIYGIDMTG----PVPTQEDISRVLEESDQIEVLLIGTGVELLR-LPEELRVLLWEKRISSDTMSTGAAVRTFNVLLAEDRAVAALLF... 115
4 -7.780d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}  ali model 3D-neighbors follow..  15  1.....................................................TKYSESYCDVLIVGAGPAGLMAARVLSEYVRQKPDLKVRIIDKRSTCRTLESLKNLG........... 68
5 -7.760d4c7va3 c.48.1.0 (A:527-662) automated matches {Lactobacillus salivarius [TaxId: 362948]}  ali model 3D-neighbors follow..  28  22.........................................................ENEADGILIATGSEVGLAL--KAKEELQKKGKDVIVVSLPS....................... 60
6 -7.580d2r5na3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  19........................................................CAGQPELIFIATGSEVELAV--AAYEKLTAEGVKARVVSMP-STDAFDKQDAAYRESVLPKAVT. 79
7 -7.560d1s3ea1 c.3.1.2 (A:3-289,A:402-501) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1..........................................................NKCDVVVVGGGISGM-----AAAKLLHDSGLNVVVLEARDRVRTYTLRNQKVKYV........ 52
8 -7.520d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}  ali model 3D-neighbors follow..  13  1........................................................MDIKYDVVIVGSGPIGCT-----YARELVGAGYKVAMFDIGEI...................... 38
9 -7.440d3c20a3 d.58.18.0 (A:404-470) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  12  4..............................................................ISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKL.. 60
10 -7.380d5hyva3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]}  ali model 3D-neighbors follow..  14  1........................................EGSSIEKASKGGYTLVQQDKADIIIVATGSEVSLAV--DALKVLEGQGIKAGVVSLPD....................... 56

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.