current user: public

If you have questions about the server, please let us know.

Query: d2qalt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLALast
1 -51.600d2qalt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA 85
2 -46.100d1fjgt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  31  1RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLL 85
3 -7.500d1j5wa_ d.104.1.1 (A:) Glycyl-tRNA synthetase (GlyRS) alpha chain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  15  207...................GLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAA 272
4 -6.860d2oo2a1 a.8.11.1 (A:2-75) Hypothetical protein AF1782 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  13  8.TLKWLERIEERVKEIEGDEGFMRNIEAYISDSRYFLEKGDLVRAFECVVWAWAWLEIGLEVGKLH................... 72
5 -6.800d2z76a_ d.17.4.3 (A:) Hypothetical protein Rv0760c {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}  ali model 3D-neighbors follow..  11  1......................QSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTH. 62
6 -5.840d2odma_ a.23.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}  ali model 3D-neighbors follow..  18  38.........................................EEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKL. 80
7 -5.700d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}  ali model 3D-neighbors follow..  19  1.....................VDSAAGNVVKQFHAALQMGNEAIVRQSLAANVQIYE............................ 36
8 -5.690d2g3ba2 a.121.1.1 (A:74-189) Putative transcriptional regulator {Rhodococcus sp. RHA1 [TaxId: 101510]}  ali model 3D-neighbors follow..  16  34...SAVYEEALRDPLARTTAAWVSEIADAIVQAQATGEISRSLDPQPTAVTMTALVEGLSGRWLCKEISTEDARSHLLGAIDVV. 114
9 -5.600d2hx1a1 c.108.1.0 (A:1-283) automated matches {Cytophaga hutchinsonii [TaxId: 985]}  ali model 3D-neighbors follow..  19  4.......................ESFKSLLPKYKCIFFDGVLKTYNGLLPGIENTFDYLKAQGYIVTNDASRSPEQLADSYHKLG 70
10 -5.580d2f5tx2 d.136.1.5 (X:110-246) Transcriptional regulator TrmB {Thermococcus litoralis [TaxId: 2265]}  ali model 3D-neighbors follow..  6.......................RSFDEAIEMFRESLYSAKNETPSEFFETIREDLIKTLERGV..................... 50

FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 6 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.