current user: public

If you have questions about the server, please let us know.

Query: d2v0na3 d.58.29.2 (A:294-454) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst LTGLHNRRYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNVRAIDLPCRYGGEEFVVIMPDTALADALRIAERIRMHVSGSPFTVAHGREMLNVTISIGVSATAGEGDTPEALLKRADEGVYQAKASGRNAVVGKAALast
1 -94.700d2v0na3 d.58.29.2 (A:294-454) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]}  ali model 3D-neighbors  100  1LTGLHNRRYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNVRAIDLPCRYGGEEFVVIMPDTALADALRIAERIRMHVSGSPFTVAHGREMLNVTISIGVSATAGEGDTPEALLKRADEGVYQAKASGRNAVVGKAA 161
2 -8.690d4wp9a1 d.58.29.0 (A:54-219) automated matches {Mycobacterium avium [TaxId: 1764]}  ali model 3D-neighbors follow..  16  2...........................VVILFTDIEESTALNERIGDRAWVKLISSHDKLVSDLVRRQS-VVKSQGDGFMVAFARP--EQAVRCGIELQRALRRNANRKRHEEIRVRIGIHMGRSVRRGDDLFGRNVAMAA.................... 114
3 -7.650d1ybta_ d.58.29.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}  ali model 3D-neighbors follow..  13  6...........................ATIMFTDIVGSTQHAAALGDDRWRDLLDNHDTIVCHEIQRFG-EVNTAGDGFVATFTSP--SAAIACADDIVDAVAALGIE-------VRIGIHAGEVEVRDASHGTDVAGVAVHIGARVCALAGPSEVLVSST 131
4 -7.380d3r5ga_ d.58.29.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  10  1.....................ETQRKKLTVFFSDIRGFTELSEELEAEALTDLLNNYLNEMSKIAKYGGTIDKFVGDCVMVFFAKKDAVAAVSMGIAMRKHMKVLRQQWRAQGITKPLEIRMGINT................................... 113
5 -7.150d4c82a_ d.79.5.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}  ali model 3D-neighbors follow..  28..............NNDFNKNEQSFKTLTLGGVKINNVLVL----SHSDGDIIYHSIVDSILGALGSLDI-----GTLFPDKDEKNKNKNSAIFLRYARLLIYKKNYDIGN----VDINVIAQVPKISNIRKNIIKNISTVSQISVKGKTHGEKKAIECFA 172
6 -6.910d1m7ga_ c.37.1.4 (A:) Adenosine-5`phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}  ali model 3D-neighbors follow..  18  29LTGLSAS---KSTLAVELEHQLVRDRRVHAYRLDGDNIRFLNKDLGFSEADR---------NENIRRIAEVAKLFADSNSIAI--SFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPV----------EVAEQRDPKGLYKKAREGV........ 160
7 -6.900d3lasa_ c.53.2.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}  ali model 3D-neighbors follow..  14  13.....NQAYVDLHGTAHLPLKPK---TRVAIVTCMDSRLHVAPALGLALGDAILRNAGGRVTDDIRSLVISEQQLGTSEIVVLHHTDCGAQTFTNAEFTEQLKRD........................................................ 111
8 -6.470d4jz6a1 c.82.1.0 (A:1-483) automated matches {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  15  184ITQCVQEAGLPAGVLNYLNSSPDRSPEIADALISAKEIRRINFTGSTRVGSIIAQKAAQHLKR------CLLELGGKSPLIVLDDADINAAVKIADEFVARFVEKTERLSVGDPCLTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGMAQ...... 357
9 -6.450d1ylka1 c.53.2.0 (A:2-163) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  10  10.....NVDY----ASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAVIRNAGCVVTDDIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESYPDAVEDVRQ................................... 128
10 -6.330d3teoa_ c.53.2.0 (A:) automated matches {Acidianus sp. [TaxId: 1071056]}  ali model 3D-neighbors follow..  11  1VSEYIDSELKRLEDYALRRVKGIPNNRRLWVLTCMDERVHIEQSLGIQPDDAIYRNAGGIVTDDIRSASLTTNFFGTKEIIVVTHTDCGMLRFTGEEVAKYFISKGIK..................................................... 110

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.