current user: public

If you have questions about the server, please let us know.

Query: d2wsda3 b.6.1.0 (A:357-512) automated matches {Bacillus subtilis [TaxId: 1423]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst SYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHALEHEDYDMMRPMDITDPHLast
1 -91.400d2wsda3 b.6.1.0 (A:357-512) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors  100  1SYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHALEHEDYDMMRPMDITDPH 156
2 -58.400d4e9sa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  24  52HMGHGNMNHMNHGGKFDFH--------HANKINGQAFDNKPMFAAAKGQYERWVISGVGDMLHPFHIHGTQFRILSENG------------------KPPAAHRAGWKDTVKVEGNV-SEVLVKFNPKEHAYMAHCHLLEHEDTGMMLGFTV.... 181
3 -29.900d2bw4a2 b.6.1.3 (A:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}  ali model 3D-neighbors follow..  11  42...................KAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQNRDTRPHLIGGHGDYVWATGKFRNP-------------------PDLDQETWLIPGGTAGAAFYTFRQ-PGVYAYVNHNLEAFELGAAGHFKVTGEW 160
4 -29.400d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  12  1.............KQHVLSKSWNQTSSLMYTVNGYVNGTMPDITVCAHDHISWHLIGMSSGPFSIHFNGQVLEQNHHK-----------------------------ISAITLVSATSTTANMT-VSPEGRWTIASLIPRHFQAGMQAYI...... 116
5 -28.300d2q9oa3 b.6.1.3 (A:344-559) Laccase {Fungus (Melanocarpus albomyces) [TaxId: 204285]}  ali model 3D-neighbors follow..  20  4...PVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKQVDAVDQWTYWLIGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFR-TDNPGAWLFHCHIAWHVSGGLSVDFLERPAD 180
6 -27.400d4enza2 b.6.1.0 (A:193-338) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21.LEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMG---NEVDVHAAFFHGQALTNKNYR------------------------IDTINLFPATLFDAYMV-AQNPGEWMLSCQNLNHLKAGLQAFFQVQE.. 145
7 -26.700d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  11  21........DKKPTRSWRRASSEVKNSHEFHAINGMIYNLP-GLRMYEQEWVRLHLLNLGGSRHVVHFHGQTLLENGTQQHQ--------------------------LGVWPLLPGSFKTLEMK-ASKPGWWLLDTEVGEIQRAGMQTPFLIV... 139
8 -26.500d4knua2 b.6.1.0 (A:154-309) automated matches {Nitrosomonas europaea [TaxId: 228410]}  ali model 3D-neighbors follow..  1............DREYVLIQAMMQNKWSNVVFNGGVFKATSWLQAKPGERVRIYFVNAPNELSSLHPIAGIWDRVYPSGNPKNVQYA--------------------LQSYLIGAGDAATLDLISPV-EGANAIVDHSMRHAHSGAIAVIMFTNDA 143
9 -25.400d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]}  ali model 3D-neighbors follow..  11  38.............................VVFNGHVGALTGDNKAKAGETVRMYVGNGGPNVSSFHVIGEIFDKVYVEGGKLINEN---------------------VQSTIVPAGGSAIVEFKVDI-PGNYTLVDHSIFRANKGALGQLKVEGAE 146
10 -25.000d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}  ali model 3D-neighbors follow..  19  79..................................GVYQFKIGEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYGDGKFSAEEESSLNLKNPPL----------RNTVVIFPYGWTAIRFV-ADNPGVWAFHCHIEPHLHMGMGVVFAEGVEK 189
11 -23.700d4knua1 b.6.1.0 (A:25-153) automated matches {Nitrosomonas europaea [TaxId: 228410]}  ali model 3D-neighbors follow..  15  8...........HAVETDVAYDNKGSTYRAWTFDGKVPGPVV--RVTEGDTVEFTLINNSKNSHSMDFHAARLD--------------------------------VVEDFESIKPGETKKYTFT-ADNPGVFFYHCGMIQHIARGMYGVIIVDPKD 122
12 -23.400d3pxla3 b.6.1.0 (A:301-499) automated matches {Trametes hirsuta [TaxId: 5327]}  ali model 3D-neighbors follow..  14  31.......................NFNGSNFFINGASFVPPTVPVLASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYDNPIF-----------------RDVVSTGTPAA--VTIRFTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPD 173
13 -20.400d2cala_ b.6.1.1 (A:) automated matches {Thiobacillus ferrooxidans [TaxId: 920]}  ali model 3D-neighbors follow..  13  28.....TVTYSGKTVHVVAAAVLPGFPFPSFEVHD----KNPTLEIPAGATVDVTFINTNGFGHSFDI--------------------TKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGMAATGMFGKIVV.... 152
14 -19.200d2bw4a1 b.6.1.3 (A:7-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}  ali model 3D-neighbors follow..  12  22..HDQVAKTGPRVVEFTMTIEEEGTEIHAMTFNGSVPGPLM--VVHENDYVELRLINPD---TNTLLHNIDFH---------------------------ATGALGGGALTQVNPGEETTLRFK-ATKPGVFVYHCAVPWHVTSGMNGAIMVLPRD 154
15 -18.100d4e9sa1 b.6.1.3 (A:29-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  7PIPDLLTTDARNRIQLTIGAGQGGKTATTWGYNGNLLGPAV--KLQRGKAVTVDIYNQLTEETTLHWHGLEV-----------------------------PGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHRQVAMGLAGLVVIEDDE 138
16 -16.700d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]}  ali model 3D-neighbors follow..  14  8.....NVVNETPAQTVEVR-----------AAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQ-H----NWVLVNGGDDVAAAVNTAAQNNADALFVPPPDTPNALAWTAMLNAGESGSVTFRTPA-PGTYLYICTFPGHYLAGMKGTLTVTP.. 139
17 -16.600d2ccwa_ b.6.1.1 (A:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]}  ali model 3D-neighbors follow..  11................................DAMQYNVKEIVVDKSCKQFTMHLKHVGKMAKVAMGH----NLVLTKDADKQAVATDGMGAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSAAGENYAYFCSFPGH--AMMKGTLKLGS.. 129
18 -15.900d3cvba_ b.6.1.1 (A:) Plastocyanin {Phormidium laminosum [TaxId: 32059]}  ali model 3D-neighbors follow..  20  17......................................EPANVTVHPGDTVKW--VNNKLPPHNILFDDKQV-----------------------PGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYC--APHRGAGMVGKITV.... 103
19 -14.900d2bz7a_ b.6.1.1 (A:) Plastocyanin {Dryopteris crassirhizoma [TaxId: 97234]}  ali model 3D-neighbors follow..  12  9...............................VGNFKFY-PDSITVSAGEAVEF--TLVGETPHNI--------------------VFDIPAGAPGTVASELKAASMDENDLLSEDEPSFKAKV---STPGTYTFYCTP--HKSANMKGTLTV.... 101
20 -13.600d3pxla1 b.6.1.0 (A:1-130) automated matches {Trametes hirsuta [TaxId: 5327]}  ali model 3D-neighbors follow..  15  16....................SPDGFSRQAVVVNGVTPGPLVA--GNIGDRFQLNVIDTMLKSTSIHWHGFF------------------------------QHGTNWADGPAISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPN 130
21 -13.600d4dp9x_ b.6.1.1 (X:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}  ali model 3D-neighbors follow..  17  15......................................VPSEFSISPGEKIVF--KNNAGFPHNIVFDEDSI-----------------------PSGVDASKISMSEEDLLNAKGETFEVAL---SNKGEYSFYC--SPHQGAGMVGKVTV.... 98
22 -13.500d4enza1 b.6.1.0 (A:1-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  79...........................................KAETGDKVYVHLKNLASRPYTFHSHGITYY-----------------KEHEGAIYPDNTTDFQRADD--VYPGEQYTYMLLATEEQSPRIYHSHIDAPKDSGLIGPLIICKKD 184
23 -13.100d2aana_ b.6.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 1108]}  ali model 3D-neighbors follow..  14  9..............................SKGEELAFDKTELTVSAGQTVTIRFKNNSAVQQHNWI------LVKGGEAEAANIANAGLSAGPAANYLPADKSNIIAESPLANGNETVEVTFTAPA-AGTYLYICTVPGH--PLMQGKLVV.... 122
24 -13.000d2iwka2 b.6.1.0 (A:467-597) automated matches {Achromobacter cycloclastes [TaxId: 223]}  ali model 3D-neighbors follow..  12  29..................EAVIRDGNKVRVYMTSVAPSFSQPSTVKEGDEVTVIVTNLDEIDDLTH----GFTM------------------------------GNHGVAMEVGPQQTSSVTFV-AANPGVYWYYCQWFCHALHMEMRGRMFVEP. 131
25 -12.800d4enza3 b.6.1.0 (A:339-553) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  97...........................................WAEVGDTIRVTFHNKGAYPLSIEPIGVRFNKNNEGTYYSPNYNPQSRSVPPSASH--------------VAPTETFTYEWTVPKEVGPKMYYSAVDPTKDTGLIGPMKICKKG 206
26 -12.200d2qdva_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}  ali model 3D-neighbors follow..  16  1.......DKATIPSESPFAAAEVADGAIVVDIAKMKYE-TPELHVKVGDTVTW--INREAAPHNV-------------------------------HFVAGVLGEAALKGPMMKKEQAYSLTF---TEAGTYDYHCTP--HP--FMRGKVVV.... 104
27 -12.000d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}  ali model 3D-neighbors follow..  15  1..........SQIRHYKWEVEYNCNENIVMGINGQFPGPTIR--ANAGDSVVVELTNKHTEGVVIHWHGIL------------------------------QRGTPWADGTAINPGETFFYNFTVDNP-GTFFYHGHLGMQRSAGLYGSLIVDPPQ 125
28 -11.800d4enza5 b.6.1.0 (A:706-884) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  89...........................................HADVGDKVKIIFKNMATRPYSIHAHGVQTESSTVTP---------------------------------TLPGETLTYVWKIPERSGAWAYYSTVDQVKDSGLIGPLIVCRP. 179
29 -11.600d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]}  ali model 3D-neighbors follow..  14  17....................ELNVEGVTVKNIRAFNVLEPETLVVKKGDAVKVVVENKSPISEGFSIDAFGVQE-------------------------------------VIKAGETKTISFT-ADKAGAFTIWCQL--PKNIHLPGTLNVVE.. 112
30 -10.400d2q9oa1 b.6.1.3 (A:1-162) Laccase {Fungus (Melanocarpus albomyces) [TaxId: 204285]}  ali model 3D-neighbors follow..  15  51......................GVVKEKVMLINGNIMGPNIV--ANWGDTVEVTVINNVTNGTSIHWHGIH------------------------------QKDTNLHDGA-IPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPA 159
31 -10.100d3ef4a_ b.6.1.0 (A:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}  ali model 3D-neighbors follow..  19  20......................................QPGFVKVEAGDTVKFV---PTDKSH---------NAESVREVWPEGV-----------------------APVKGGFSKEVVFNA---EKEGLYVLKC--APHYGMGMVVLVQVGKPV 97

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.