current user: public
If you have questions about the server, please let us know.

Query: d2x9aa_ b.37.1.0 (A:) automated matches {Enterobacteria phage [TaxId: 10868]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
# Score Template Links and tools%idFirst TTDAECLSKPAFDGTLSNVWKEGDSRYANFENCIYELSGIGIGYDNDTSWNGHWTPVRAADLast
1 -53.300d2x9aa_ b.37.1.0 (A:) automated matches {Enterobacteria phage [TaxId: 10868]}  ali model 3D-neighbors  100  1TTDAECLSKPAFDGTLSNVWKEGDSRYANFENCIYELSGIGIGYDNDTSWNGHWTPVRAAD 61
2 -44.300d1g3pa1 b.37.1.1 (A:1-65) N-terminal domains of the minor coat protein g3p {Bacteriophage M13 [TaxId: 10870]}  ali model 3D-neighbors follow..  32  2ETVESCLAKSHTENSFTNVWKDDKDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAI 64
3 -41.200d4eo1a_ b.37.1.0 (A:) automated matches {Enterobacteria phage [TaxId: 10867]}  ali model 3D-neighbors follow..  30  3TPEEICEAKPPIDGVFNNVFKDEGGFYINYNGCEYEATGVTVCQNDGTVCSSAWKPTGYV. 64
4 -7.580d1g3pa2 b.37.1.1 (A:91-217) N-terminal domains of the minor coat protein g3p {Bacteriophage M13 [TaxId: 10870]}  ali model 3D-neighbors follow..  16  42.................NTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSS.. 83
5 -5.730d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2..KIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCGGFRISEENETTCMGKWSSPPQCE 62
6 -5.530d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1................................CENELLKFSYIRTSFDKILLRWEPYWPPD 29
7 -4.930d2hg6a1 d.364.1.1 (A:1-106) Hypothetical protein PA1123 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  20  4TSTDICQAADALKG-FVGFNRKTGRYIVRFS----DSFGMDVADDSITPTSE-WSSVR... 58
8 -4.810d1wwra1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  18  50TAHAEMLAIKEACRRLNTKYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSALDKKHGGVV 110
9 -4.750d1iuja_ d.58.4.5 (A:) Hypothetical protein TT1380 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  9  11........RPEYAEQFEEAFRQRARLVDRMPGFIRNLVLRPKNPGDPYVVMTLWESEEAFR 63
10 -4.730d1ut3a_ g.9.1.1 (A:) Beta-defensin, BD {King penguin (Aptenodytes patagonicus), spheniscin-2 [TaxId: 9234]}  ali model 3D-neighbors follow..  14  11..........................FCARGRCRFPSIPIGRCSRFVQCCRRVW....... 38
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.