current user: public
If you have questions about the server, please let us know.

Query: d2xg5a2 b.7.2.1 (A:125-217) PapD {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst NEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKKELast
1 -65.400d2xg5a2 b.7.2.1 (A:125-217) PapD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1NEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKKE 93
2 -46.100d1ze3c2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  28  3PDQAAEKLRFRRSANSLTLINPTPYYLTVTELNAGTRVL-----ENALVPPMGESTVKLPSGSNITYRTINDYGALTP............... 77
3 -45.400d4ay0a2 b.7.2.0 (A:131-217) automated matches {Yersinia pestis [TaxId: 632]}  ali model 3D-neighbors follow..  21  5.IQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSI-----PSHYIPPKSTWAFDLPGARNVSWRIINDQGGLDR............... 80
4 -33.600d4djma2 b.7.2.0 (A:153-213) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  5.DDVAGKVEWQRAGNRLKGVNPTPFYINLSTLTVGGKEVK----EREYIAPFSSREYPLPAG............................... 61
5 -8.760d1v8ha1 b.1.18.19 (A:2-107) Sulfur oxidation protein SoxZ {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  11  22...............QVVAQHPNAKYINLVEVYFEGEKVAEARPGPSTSAPLYAFKFKAEKAGTFTIKLKDTDGDTGEASVKLE......... 105
6 -8.230d2oxga_ b.1.18.0 (A:) automated matches {Paracoccus denitrificans [TaxId: 266]}  ali model 3D-neighbors follow..  8  23...............KALISHKMRSIINRFTCELNGVNVVDVAIDPAVSTPYFEFDAKVDAAGEFKFTWYDDDGSVYEDVKPIA......... 106
7 -7.700d1xo8a_ b.1.25.1 (A:) Putative dessication related protein LEA14 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  6  44...............KVSVTNPYSHSIPICEISFGREIGKGKIPDPGSLKAKDMTALDIP................................. 93
8 -7.290d2cria1 b.1.11.0 (A:8-141) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  11..DPPSDLKFDVVTTNLKLQNPSDRKVCF-KVKTTAPRRYCVRPNSGIIDPGSIVTVSV.................................. 71
9 -7.130d1wica1 b.1.11.2 (A:8-146) MSP domain containing protein 2, Mospd2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  9  15..SPAEELYFGSIESGIVLTNVTKNIVAF-KVRTTAPEKYRVKPSNSSCDPGASIDIIVSPHGGLTVSAQDRF.................... 89
10 -7.030d2jlia_ d.367.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}  ali model 3D-neighbors follow..  17  5.EIQSRNMRENVKRSSVVVANPTHIAIGI................................................................ 32
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.