current user: public

If you have questions about the server, please let us know.

Query: d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst KINFLRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPPGIDLASVEWLVVDESDKLFEDGKTGFRDQLASIFLACTSHKVRRAMFSATFAYDVEQWCKLNLDNVISVSIGALast
1 -113.000d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1KINFLRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPPGIDLASVEWLVVDESDKLFEDGKTGFRDQLASIFLACTSHKVRRAMFSATFAYDVEQWCKLNLDNVISVSIGA 240
2 -94.200d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  1..........VEATGNNCPPHIESFSDV----EMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIR-DLERGCHLLVATPGRLVDMMERG--KIGLDFCKYLVLDEADRMLD---MGFEPQIRRIVEQDPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVG. 239
3 -88.500d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  8............GEKRLIPKPTCRFKDA---FQQYPDLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPRNGPGMLVLTPTRELALHVEAECSKYSY-KGLKSICIYGGRNRNGQIE-DISKGVDIIIATPGRLNDLQMNN--SVNLRSITYLVIDEADKMLD---MEFEPQIRKILLDVRPD-RQTVMTSATWPDTVRQLALSYLKDPMIVYV.. 227
4 -86.700d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  1..........ILVEGDGIPPPIKSFKEM----KFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEREGPYGLIICPSRELARQTHGILEYYCRLLQLRCALCIGGMSVKEQME-TIRHGVHMMVATPGRLMDLLQKKM--VSLDICRYLALDEADRMID---MGFEGDIRTIFSYFKGQ-RQTLLFSATMPKKIQNFAKSALVKPVTINVGR 232
5 -79.000d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  10..................EEETKTFKDL----GVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETP-QRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSL-ALAKKPHIIIATPGRLIDHLENTKG-FNLRALKYLVMDEADRILN---MDFETEVDKILKVI-PRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSS 220
6 -75.800d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  32  1.................................MNEKIEQAIREMGFKNFTEVQSKTIPLMLQGKNVVVRAKTGSGKTAAYAIPILEL-------GMKSLVVTPTRELTRQVASHIRDIGRYMDTKVAEVYGGMPYKAQINR---RNADIVVATPGRLLDLWSKGV--IDLSSFEIVIIDEADLMFE---MGFIDDIKIILAQT-SNRKITGLFSATIPEEIRKVVKDFITNYEEIEAC. 191
7 -74.600d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  5.............................EDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERL-DLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGAKVMATTGGTNLRDDIM-RLDDTVHVVIATPGRILDLIKKGV--AKVDHVQMIVLDEADKLLS---QDFVQIMEDIILTL-PKNRQILLYSATFPLSVQKFMNSHLQKPYEINL.. 206
8 -74.200d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  25  3...............TNYDKVVYKFDDM----ELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRI-DTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEG---RDAQIVVGTPGRVFDNIQRRR--FRTDKIKMFILDEADEMLS---SGFKEQIYQIFTLL-PPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV.. 212
9 -74.000d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  4.............................RDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQL-EPVTGQVSVLVMCHTRELAFQISKEYERFSKYMNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKS--LNLKHIKHFILDECDKMLE--QLDMRRDVQEIFRMT-PHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV.. 207
10 -73.800d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  26  4.............................TRFPFQPFIIEAIKTLRFYKPTEIQERIIPGALRGESMVGQSQTGTGKTHAYLLPIMEKIKPERAE-VQAVITAPTRELATQIYHETLKITKFCMIVARCLIGGTDKQKAL-EKLNVQPHIVIGTPGRINDFIREQA--LDVHTAHILVVDEADLMLD---MGFITDVDQIAARM-PKDLQMLVFSATIPEKLKPFLKKYMENPTFVHV.. 208
11 -73.300d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  29  4.............................KDFPLKPEILEALHGRGLTTPTPIEAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLAPSQERGPRALVLTPTRELALQVASELTAVAP--HLKVVAVYGGTGYGKQKE-ALLRGADAVVATPGRALDYLRQGV--LDLSRVEVAVLDEADEMLS---MGFEEEVEALLSAT-PPSRQTLLFSATLPSWAKRLAERYMKNPVLINVI. 206
12 -73.200d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  19..................VNEITRFSDF----PLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGKDLKHEAERI--NNINILVCTPGRLLQHMDETVS-FHATDLQMLVLDEADRILD---MGFADTMNAVIENL-PKKRQTLLFSATQTKSVKDLARLSLKNPEYVWV.. 230
13 -72.300d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  4.............................ESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSL-VLENLSTQILILAPTREIAVQIHSVITAIGIKMGLECHVFIGGTPLSQDKTR---KKCHIAVGSPGRIKQLIELDY--LNPGSIRLFILDEADKLLEEGS--FQEQINWIYSSL-PASKQMLAVSATYPEFLANALTKYMRDPTFVRL.. 205
14 -68.800d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  28  1.....................AKSFDEL----GLAPELLKGIYAMKFQKPSKIQERALPLLLHNRNMIAQSQSGTGKTAAFSLTMLTRV-NPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNK-----QINAQVIVGTPGTVLDLMRRKL--MQLQKIKIFVLDEADNMLD--QQGLGDQCIRVKRFL-PKDTQLVLFSATFADAVRQYAKKIV.......... 196
15 -56.500d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  19  2..........AAAAAAAAAAAAASLCLFPEDFLLKE--FVEFFRKCVGEPRAIQKMWAKRILRKESFAATAPTGVGKTSFGLAMSLFLAL----KGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENLIGYYHGRIPKREKENRNFKIVITTTQFLSKHYR------ELGHFDFIFVDDVDAILKASKLGFHYDLKTKSWVG-EARGCLMVSTATAKKGKKAELFRQL---LNFDIGS 228
16 -29.200d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  25  9................................SISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAI----KGGKSLYVVPLRALAGEKYESFKKWEK-IGLRIGISTGDYESRDE------GDCDIIVTTSEKADSLIRNRASW--IKAVSCLVVDEI-HLLDSEKRGATLEILVTKMRRMNKALRVIGLSATAPN.................... 184
17 -22.000d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  19  113................................................EPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLARYYLENYEGK---ILIIVPTTALTTQMADDFVDYRLFSHAMIKKIGGGASKDDK----YKNDAPVVVGTWQTVVKQPKE------FSQFGMMMNDECHLA--------GKSISSIISGLNNCMFKFGL-SGSLRDG................... 265
18 -21.500d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  21  4............................AEVLNLESGAKQVLQETGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLL---------LTVVVSPLISLMKDQVDQLQA----NGVAAACLNSTQTREQQMTGCRTGQIRLLYIAPERLML--DNFLEHLAHWNPVLLAVDEAHCISQWGH-DFRPEYAALGQLRQRPTLPFMALTATADDTTRQDIVRLLG......... 197
19 -20.900d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  17  9................................................QPRIYQEVIYAKCKE-TNCLIVLPTGLGKTLIAMMIAEYRLTKYGG---KVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALTGEKSPEER--SKAWARAKVIVATPQTIENDLLAG--RISLEDVSLIVFDEAHRAVGN-------AYVFIAREYKRQAKNPLVIGLTASEKIMEVINNLGIEHIEY.... 187
20 -20.100d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  18  1...........................................................MLKKGMTTVLDFHPGAGKTRRFLPQILAECAR---RRLRTLVLAPTRVVLSEMKEAFHGLDVKFHTQA------------FSAHGSGREVIDAMCHATLTYRMLEPT---RVVNWEVIIMDEAHFLDPASIA-----RGWAAHRARANESATILMTATPP..................... 138
21 -15.600d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  22  70................................................SLRDYQEKALERWLVDKRGCIVLPTGSGKT-------HVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGEEY--------------GEFSGRIKELKPLTVSTYDSAYVNAEKLGNRFML-----LIFDEVHHL--------AESYVQIAQMSIAPFR--LGLTAT....................... 204
22 -15.600d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  18  3..........................................................AVPQSFQVAHLHAPTGSGKSTK--VPAAYA-----AQGYKVLVLNPSVAATLGF---GAYMSKAHGVDPNIRTGVRTITT--------GSPITYSTYGKFL-----ADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQA----TAGARLVVLATAT....................... 135
23 -15.100d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  16  85..................................................TNAQKRAHQEIRNDMNRLLQGDVGSGKTVVAQLAILDNYEA----GFQTAFMVPTSILAIQHYRRTVESFSKFNIHVALLIGATTPSEKKSGLRNGQIDVVIGTHALIQE-------DVHFKNLGLVIIDEQHR--------FGVKQREALMNKGKMVDTLVMSATPIPRSM.................. 246
24 -13.900d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  16  4..........................................................PSMLKKKQLTVLLHPGAGKTRRVLPEIVREAIKKRL---RTVILAPTRVVAAEMEEALRGLPVRY------------MTTAVNVTHSGTEIVDLMCHATFTSRLLQPI---RVPNYNLNIMDEAHFTDPSSIAA----RGYISTRVEMGEAAAIFMTATPPGTRDAFPDS............ 152
25 -12.600d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  55................................................ETTPDQAQAINAVLSDMDRLVCGDVGFGKTEVAMRAAFLAVD----NHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQLAEVAEGKIDILIGT--KLL------QSDVKFKDLGLLIVDEEHRF-----VRHKERIKAMRANV-----DILTLTATPIPRTLNMAMSGMRDLSIIAT.. 233
26 -12.200d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  17  82.......................................KYVDILKIRRELPVRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACT-QPRRVAAMSV---AQRVAEEMDVKLGEEVG----SIRFENKTSNKTILKYMTDGMLLREAMEDH---DLSRYSCIILDEAERTLATD-MGLLKQVVK-----RRPDLKIIIMSATL--DAEKFQRYFNDAPLLAVPG. 269
27 -10.800d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  20  81...................................................PFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALTGKG----VHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEK---REAYAADITYSTNNELRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEA.................................................. 217
28 -10.400d2gk6a1 c.37.1.19 (A:295-324,A:416-702) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  91.....................................................QVYAVKTVLQRPLSLIQGPPGTGKTVT-SATIVYHLARQGNG--PVLVCAPSNIAVDQLTEKIHQ----TGLKVVRLCAKSALKRTAERELLMNADVICCT------CVGAGDPRLAKMQFRSILIDESTQATEPECMGDHCQLGPVVMCKKAAKASQSLFERLVVLGIRPI............... 312
29 -10.100d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  153.....................................................QKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESL---------------GKALRQLPLTDEQKKRIPEDASTLHRLLGAQPGSQRAGNPLHLDVLVVDEAS-MID-------PMMSRLIDALPDHARVIFLGDRDQLASVE--AGAVLGDICA..... 314

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.