current user: public
If you have questions about the server, please let us know.

Query: d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst NNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFGLast
1 -55.600d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1NNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG 79
2 -35.200d1kjqa1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  9  1.GPAASAVILPQLTSQNVAVGADLQIRLFGKEIDGSRRLGVALATAESVVDAIERAKHAAGQVKVQG............ 74
3 -7.440d1n2xa1 a.60.13.1 (A:115-215) Putative methyltransferase TM0872, insert domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  11  19ESEVTAQKVLNELPEEELARI----IFEYGEEKRFARRIARKIVENRPLNTTLDLVKAVREALPSY............. 80
4 -7.070d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  11  159.....LPKVIGNRSLVNELTFTARKM-----MADEALDSGLVSRVFPDKDVMLNAAFALAADISSKSPVAVQGSKINL. 226
5 -6.600d5u1ma_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  32......ISFVKLNSEAAAVVLQLMNIRRCGHSEEVGRSAGEFWMQVDDSVVAQNMHETILEAMRAMSDAF......... 104
6 -6.340d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  17  158.....LPHLIGRGRTAHLALTGEA-------DAATAERWGLVTEVLPDQDALFARAEALAEHLAALPAKALEGTKRAL. 224
7 -6.040d1vq8e2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}  ali model 3D-neighbors follow..  13  20GDEVVIENFLGEKAPRRTTIHGDTDVEIDGEE---------LTVSGPDIEAVGQTAADIEQLTRINDKD.......... 79
8 -5.980d3hpya2 d.32.1.0 (A:147-289) automated matches {Pseudomonas sp. [TaxId: 237609]}  ali model 3D-neighbors follow..  10  4....................................IQLDHCLLYGPNIAEVQKIFTEVLGFYLVE............. 33
9 -5.960d1xv2a_ d.290.1.1 (A:) Hypothetical protein SA2394 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  17  152.......AIVGTPELFHGVGSAGFHIHFADDERAYG---GHVDFEVDDVVVEIQNFETFQQHFPVNNET.......... 213
10 -5.910d1z0kb1 a.2.19.1 (B:441-501) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  2  26.........................ITSFIRQAKAAGRMDEVRTLQENLRQLQDEYDQQQT.................. 61
FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 9 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;