current user: public

If you have questions about the server, please let us know.

Query: d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGILSGMNPKGYIDDEAAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPALast
1 -98.100d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors  100  1MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGILSGMNPKGYIDDEAAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPA 289
2 -75.000d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  17  1.......................KLASTMEGRVEQLAEQRQVIEGGGERRVEKQHSQGKQTARERLNNLLDPHSFDEVGAFRKHRTAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGK----MFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQVIKSVT-------------------GEDVTADELGGAEAHMAISGNIHFVAEDDDAAELIAKKLLSFLPQ 251
3 -57.900d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  4...............................KCDSCGQVLYRALERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGSELEPQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQM---AKTSAALAKMQERGLPYISVLTDPTMGGVSASAMLGDLNIAEPKALIGFAGPRVIEQTVREKLP--------------------PGFQRSEFLIE-KGAIDMIVRRPELKLASILAKLMNLPA 260
4 -52.200d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  16  1...............TEEASFVNPNNDVSPN--TELRDIVPI------------DGKKGYDVRDVIAKIVDWGDYLEVKAGY--------ATNLVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYA---YSEATVPKITVVLRKAYGGSYLAMCNADAVYAWPSAEIAVMGAEGAANVIFRKEIKAADDPDAMRAEKIEEYQNAF---NTPYVAAARGQVDDVIDPAD-----TRRKIA.... 241
5 -47.200d2f9ia1 c.14.1.0 (A:1-314) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  12  9........FEIRNKIESLKESQDKNDVDLQEEIDMLEASLERETKKPWDRVQIARLQERPTTLDYIPYIFDSFMELHGDRNFRDD------PAMIGGIGFLNGRAVTVIGQQRYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLI---EMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIAAE--TMKITAHDIKQLGIIDDVISEPLGGAHKDIEQQALAIKSAFVAQLDSLES 292
6 -47.200d3gf3a2 c.14.1.4 (A:292-587) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  13  2................NLEFFRVDTPKAPQLPAEDLYSIIPM------------NQKRPYDIYEVIARLFDNSEFSEYKKGY--------GPEMVTGLAKVNGLLVGVIANVQGLIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYS---IENSKLPSLEITIRKASAAAHYVLGGPQGSIGTGACEYYVMPGETAANAMKLVKAKKAGEDLQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTE-----VRPYI..... 263
7 -46.400d3tdca1 c.14.1.0 (A:1719-2042) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  4..............................VTKDLLQAKRFQAQTLGLFKLWGSPDKYPKDILTYTELVLDSGQLVEMNRLPGGNEVGMVAKMRFKTQEYPEGRDVIVIGNDITFRIGSFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWGMIAGESSLAYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYT-----------------SNNQLGGVQIMHY-NGVSHITVPDDFEGVYTILEWLSYMPK 322
8 -34.500d3tdca2 c.14.1.0 (A:2043-2451) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  1................HSPVPIITPTDPIDREIEFLPSRAPY-----DPRWMLAGRPHPTLKGTWQSGFFDHGSFKEI--------MAPWAQTVVTGRARLGGIPVGVIAVETRTVGQVWFPDSAYKTAQAIKDFNREKLPLMIFANWRGFSGGMKDMYDQVLKFGAYIVDG---LRQYKQPILIYIPPYAELRGGSWVVIDIEMYADKESRGGVLEP---EGTVEIKFRKKDLIKSMRRIDPAYKKLMEQLGEPDLSDKDRKDLEGRLKAREDLLLPIYHQVAVQF.. 280
9 -12.900d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  13.........................................................................................................VCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPGADFQEIYQEMKRGRKQASSQEPLYKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLS--GLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQE-------ASEWGLIDAFDAESDVLLRKHLLRLRRLNK 200
10 -12.500d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  13  11.........................................................................................................ASLIVLSRPEKLNAINLEMLADLADQFSKAEKEDTRVIVITGYGGADINMSFDPASAYSFRLKMNSIAQRIRKSDKPVIALLKGYSMGGGLELAESADIRIAMSDAVI---GQPESSIGINAGAGGNVILPKLVGRGSAAYLAMSGKKLNAQ-EAMALGLVDEVVDDEAKAWKIIDDICKKPK. 196
11 -12.500d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  14  18.........................................................................................................VCVVTLNRPDKRNALDVATIEELVTFFSTAHRKGVRAVVLTGAGGLDLVEHWKADRSADDFMHVCLRFNKMEYGGVPIIAALRGAVVGGGLELASAAHLRVMDQSTYFAL--PEGQRGIFTGGGATIRVSDMIGKYRMIDMILTGRVYQGQE--AADLGLAQYITEGSDKAMELADKIASNLP. 207
12 -12.400d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  11  10.........................................................................................................VLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGGADLSGDAFAADYPDRLIELH---KAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKY-DNWSIRRLSSLVGHGRARAMLLSAEKLTAEI-------ALHTGMANRIGTLA-DAQAWAAEIARLAP. 189
13 -12.200d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  12  6...................................................................................................RIEGHVAHVRLNRPQGLNAITQEMDDLLLDAWTEVNANSDIWAVVLSAEGGADVSGGAERKTRMALGGGLTGIGGPLVTCKKPMVAAVQGFCVGGGFELAMCADIIVAADTAQFGL--PETKVGIIGECGVVHRAMRQLPYHIALQLILTGERIKAD--EARHYGLVNEVVPFAEAALRWASKLNAASP. 199
14 -11.800d3oc7a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}  ali model 3D-neighbors follow..  12  12...................................................................................................ATGGPVARLTLNSPHNRNALSTALVSQLHQGLRDASSDPAVRVVVLAHTGGADLSESSAYDMAVERAREMAALMRAIVESRLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSFALTEARVAPAIISLTLLPKLSARAAARYYLTGEKFDARR-------AEEIGLITMAAEDDAAIDQLVTDVGRGSPQ 209
15 -11.800d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  11  6...................................................................................................EIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGGADLTANFTEEENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLIPAVISPYVVRAIGERAAKMLFMSAEVFDATR-------AYSLNLVQHCVPDDTFTLKYASQISNNAPE 203
16 -11.600d4k3wa_ c.14.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}  ali model 3D-neighbors follow..  11  7...................................................................................................EKQGPTLVITINRPDVRNAMSLQMVAELSTIFSEIENDISIRAAVLRGAGGGDIKDMAGARSQKAGEGAFGQMIQQVNESSKVVIAITEGAVMGGGFGLACVSDLAIAGPTAKFGMPETTVIPAQIAPFVVERIGLTQARRLALLGLRIDATE-------ACKLGIVHQVAESEEQLSDMLNQALERVRL 206
17 -11.400d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  13  7...................................................................................................ERNGPVTTVIIDRPEARNAVNGPTAAALFAAFEEFDADDTASVAVLTGANGADLKAFGTPEANQVHREGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVVDEDATMGVGGTVRLPRLIGHSRAMDLI---------TGRAVDAAE-------AYAIGLANRVVPTGQAAEELAADLARLPQ. 199
18 -11.300d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  10  22.........................................................................................................GTVATLTLAAKMGSMGPAFWQEFPQALSELGDARVLIVR---SAGLDVKSNGAAIVPALGKPDAFKAVEGLAALPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLPEVKL-DLGGLQRLPHLIGRGRTAHLALTGEAIDAAT-------AERWGLVTEVLPDQDALFARAEALAEHLAA 211
19 -11.300d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  14.........................................................................................................VAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGFSAGHDIHELPSGGRDPLSYDDPLRQITRMIPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNL-NLVGIHNLTRDAGFHIVKELIFTASPITAQR-------ALAVGILNHVVEVEEFTLQMAHHISEKAP. 203
20 -11.300d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  8...................................................................................................RKQDGFTHILLSTKSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGGLDFIYFIRRLTDDRKRESTKMAVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTF-DGCSTVMFPKIMGGASANEMLLSGRKLTAQE-------ACGKGLVSQVFWPGTEVMVRIKELASCNPV 207
21 -11.200d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  10  12...................................................................................................EIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGGMDLKEGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINW-GNLVSKAMADTVGHRQSLMYIMTGKTFGGQK-------AAEMGLVNESVPLAQVTIELARNLLEKNP. 211
22 -11.000d3myba_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  13  13.........................................................................................................VVTLTLNRPQAFNALSEAMLAALGEAFGTLAEDESVRAVVLAASGKAFCAGHDLKEMRAEPSREYYEMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVSGINLFCSTPGVALSRNVGRKAAFEMLVTGEFVSADD-------AKGLGLVNRVVAPKAEIEAMVSKIVAKPRA 203
23 -10.900d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  12  8...................................................................................................VREGAIATVTLNRPDRMNALNLPMWRGLAEAFETISADRSIHVVILRGAGGADIEEFDTLRANAEQAKAYDLVLDTVRACPQPVIAAIWGPCVGGGLELACCCDIRLSAKSGKF---GVPINKISVVMAYPELAQIRRVAGPAAALEILLEGRIMDAD-EAAAKRLVNRVVEDDAEVAATAKRIAAGAP. 205
24 -10.900d2q35a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}  ali model 3D-neighbors follow..  12  1..............................................................................................VVQLTELGNGVVQITMKDESSRNGFSPSIVEGLRHCFSVVAQNQQYKVVILTGYGGASKEFLIRKTRGEVEVLDLS---GLILDCEIPIIAAMQGHSFGGGLLLGLYADFVVFSQESVYATATSLILREKLGSELAQEYTGENYRGKELAERGIPFPVVSRQDVLNYAQQLGQKIAKSPRLSLVALKQHLS.... 206
25 -10.900d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  10  8.................................................................................................TSRPVAGVGLIRLDRPDALNALNQTLEAEVLDAARDFDADLEIGAIVVTGSEGADIAEMVTLTPHQARERNLLSGWDSLTQVRKPIVAAVAGYALGGGCELAMLCDLVIAADTARF---GQPEITLGILPGLGGTQRLTRAVGKAKAMDLCLTGRSLTAE-EAERVGLVSRIVPAADEALAVAQRIARMSR. 202
26 -10.900d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  10  10.........................................................................................................VRVITLDHPNKHNPFSRTLETSVKDALARANA-SVRAVVVYGGAGGDFNEVKQLSRSEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMLKHGIGCSVGAAILGFTHGFSTMQEIIYQCQSLDAPR-------CVDYRLVNQVVESSAAAITQAHVMASYPA. 200
27 -10.800d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  11  7...................................................................................................DIAAPLAEIVLNKPERRNALSVDMWAAIPGLVAEANANPDVKLILIHGGDGADISEYATEDAAKASGQRIAQALDAIENSEKPVIAAIEGACVGGGVSLAMAADLRVAGEGAKF---GVTPGKLGLVYPAGDTRRLLAAVGPGATKDILFTGRIFTAG-EAKSLGLIDRLVEKGTAARVWAGEIAAISQ. 204
28 -10.800d4k29a_ c.14.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  12  8...................................................................................................ETLHGVARITLNRPERTNALDQEMLGEINAAMDAAEADAGVKAVIVRGAGGFDLKAQMEARPAGVDAWRPLLRVMRFWHCPKPTIAAVRGPCLAGACELALACDMTIATEDAFFGEPELKFGAGIVVMLLPWIVGPKIAKEIILLGEDRVPAR------RAAEIGMVNRVVDGDGEALRIARHIGAIDP. 203
29 -10.800d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  1..............................................................................................MSLRLERDGAVARLLIDRADRRNAFSLDMWQRLPELLAEASGDDALRVLVVKSANGADIAEKDDAAFHAANQQAINRAQYELARFRLPTVAMVEGDCIGGGCGIALACDMRIAAPAARF---GITPAKLGLVYPLHDVKLLVDLVGPGQARRLMFTGGLIDAN-EAHRIGLVELLGESEDALVGQLAT....... 194
30 -10.800d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}  ali model 3D-neighbors follow..  10  5...................................................................................................SNHGRVAVITLNRPERLNAWTTPMRETIIDALERFNRDPEVAAIIMTGAGGQDLSEDFDGERAVAWVKEWQRYYTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRMGQTGPWIMNAMLGMSRTIELT---------TGRLMEAEE-------CHRIGLIHHLVDEDKKALEIATELAAKPP. 199
31 -10.700d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  10  7...................................................................................................NLEGGVLTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEGNDMKDFMGFVQNPNAGPAGQVPLKSAARLSKPLIIAVKGVAIGIGVTILLQADLVFADNTALFQIPFVSL-EGGASQLLVKQAGYHKAAELLFTAKKFNAET-------ALQAGLVNEIVEDAYATAQATAQHLTALPL 201
32 -10.700d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  11  11...................................................................................................AIADGVASVEISNLAQRNALTKDMCLEIQELMPQLDADPDVAVVVLRGAGGASISELASVLLDPQPDGSTADHLSAIAALSKPAVALVDGACMGGGWQIASACDFIIANERAVIGLTPAKI-PRPGLERLVRLVGHANAKYILLTGQTFSAPE-------ARALGLVADVVPSESKCAALVRSLRSRSR. 207
33 -10.500d3tlfa_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  13  9...................................................................................................EVDGHTATITLNRPDALNALSPHMITELRAAYHEAENDDRVWLLVVTGTGGADVKEERPYLSTYDQWEAPQEGTPPFRTMAKPVLTAVNGICCGAGMDWVTTTDIVIASEQATFFDIGLVAGRELVRVSRVLPRSIALRMALMGKHERMSAQR-------AYELGLISEIVEHDRRAHEIADIVNSNAP. 211
34 -10.500d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  11  14.........................................................................................................VAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSSAGLDLTEGRSPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIKDTLENTIGHRAAERALQLGLLFPPAE-------ALQVGIVDQVVPEEQTALSAIAQWMAIPD. 205
35 -10.400d4f47a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  11  1..........................................................................................GPDALV---EQRGHTLIVTMNRPSRRNALSGEMMQIMVEAWDRVDNDPDIRCCILTGAGGMDLKAPGDSFKDGSYDPSRIDALLKGRRLKKPLIAAVEGPAIAGGTEILQGTDIRVAAESAKFGI--SEAKWSLYPMGGSAVRLVRQIPYTVACDLLLTGRHITAA--EAKEMGLVGHVVPDGQKALEIAEIIAANGP. 204
36 -10.300d3rrva_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  12  10...................................................................................................RADGALRIITLNRPDSLNSVNDDLHVGLARLWQRLTDDPTARAAVITGAGGGDFGYLKELSADADLRAKTIRDVLGMARCRIPVVAAVNGPAVGLGCSLVALSDIVYIAENAYLADGGPLTWPLHISLLLAKEYA---------TGTRISAQR-------AVELGLANHVADDPVAEAIACAKKILELPQ 204
37 -10.300d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  6...................................................................................................TSEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENNPEIRSVVITGEGGGNLQRLQANRREAPEVQAQSIEIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMSYSTV-DGGGSWSLARSLPRALASELLMGGERISAQR-------LHDLGLVNKVASAGDEALRMAGQLNARAP. 203
38 -10.200d3pe8a_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  13  12.........................................................................................................VRTLTLNRPQSRNALSAELRSTFFRALSDAQNDDDVDVVIVTGADPVFCAGLD-LKELGDTTELPDISPKWPDMTKPVIGAINGAAVTGGLELALYCDILIASENAKFADTHARV-TWGLSVRLPQKVGVGLARRMSLTGDYLSAQD-------ALRAGLVTEVVAHDDAARRVAASIVGNNQ. 192
39 -10.100d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  11  13...................................................................................................TIEDHVAHVLLDRADKMNALDDAMFEGIVAAGHHLHSVKGVRCVVLSGAGGLDLSSMGRTDRWSGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVMEVKW-DMAGYALWRGNVRDDVLRELTYTHREFSGEE-------AVRFGFATHVADD-AGAMELARVVAEKSP. 212
40 -10.100d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  12  10...................................................................................................TLSDGVFSVTINRPDSLNSLTVPVITGIADAMEYAATDPEVKVVRIGGAGGAGISADDVSDGGGVPPDEIILEVRAIAALPHPVVAVVQGPAAGVGVSIALACDVVLASENAFFMLAFTKI-DGGASALVAAAVGRIRAMQMALLPERLPAAE-------ALAWGLVTAVYPAD-EFEAEVDKVIARLLS 203
41 -9.990d3gowa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  5...................................................................................................ERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGGQDLTEFGDRKPDYEAHLRRYNRVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRI-DSGLSFLLPRLVGLAKAQELLLLSPRLSAEE-------ALALGLVHRVVPAEKEALSLAKELAQGPT. 198
42 -9.990d3swxa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 36809]}  ali model 3D-neighbors follow..  14  13.........................................................................................................VLVIGLNRPAKRNAFDKTMLEELALALGEYETDTDLRAAVLYGEGPLFTAGLDLASVAAEIQGGASLTVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQ--LEVNRGIYPFGGATIRFPRTAGWGNAMRWMLTADTFDAVE--AHRIGIVQEIVPVGETAIAIAQTIARQAP. 203
43 -9.980d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  7...................................................................................................HVEGGVQVVRMNRPDKKNALIGEMYAALAEAFAKGEADDDVNVFLILGSQGNDLPDFLTWEALSGSVADRFIR--AVAGARKPVVAAVRGAAIGIGSTLLPHCDLVYAAPGTRFHMPFINL-EAGSSQTMPALAGHRRAAEMLMLGEPFGVDT-------AEAVGLINGVVPGEDTAMAAARKLAAKPRS 198
44 -9.970d5e0nx_ c.14.1.0 (X:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  11  8...................................................................................................RSRPGVALVTLNRPERMNSMAFDVMVPLLELLGDLRHDNSVRVVILTGAGGADHKSAGSVPHVDGLTRPTYALILALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYFRAAGLTASELGLSYLLPRAIGTSRAFEIMLTGRDVDAAE-------AERIGLVSRTVPDDDTCFEMAQRMRGFSR. 210
45 -9.950d3qxza1 c.14.1.0 (A:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}  ali model 3D-neighbors follow..  6...................................................................................................EIRDGVAVLTLHGPSTRNSFTVELGRQLGAAYQRLDDDPAVRVIVLTGAPGAQISAAAETFAAPRNPDFSASPVPAAFELRTPVIAAVNGHAIGIGMTLALHADIRILAEEGRYAIPQVRF-DALAHWTLPRLVGTAVAAELLLTGASFSAQR-------AVETGLANRCLPAGKAALRMAHDIATNVA. 199
46 -9.830d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  11  7.................................................................................................VTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGGIDLMDMASDILQRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQV---KEVDVGLAADVGTLQRLPKVIGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFALAADISS 213
47 -9.790d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}  ali model 3D-neighbors follow..  11  7...................................................................................................EVVNNVGWIRMNRAAKHNPFDAELRADLMTVLERVRDDADIRVLVLTSHPGGNLHVLRDNLDSGPAYWQQRIKIHDMLNLGRPVIAAVDGPAFGAGFALSLTADIVLASPRARFSMAYLRL-DLGALYLLPRAVGLQRAKELMFSTRELDAEE-------AHRLGLVMEVHESEARAREIAESLVQAAP. 204
48 -9.720d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  20.........................................................................................................VLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGGSFGLIEEMRASHEALLRVFWEVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRL-GDHAVLLWPLLVGMAKAKYHLLLNEPLTGEE-------AERLGLVALAVEDEKKALEVAERLAQGPK. 210
49 -9.540d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  7...................................................................................................DARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGGADLKETMAEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGL--TEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAE--AFSVGLANRLAPEGHVAYGLAESVVENAP. 202
50 -9.530d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  20..............................................................RPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLI-----------------------------------------AVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHL-EGCSSYTFPKIMSPAKATEMLIFGKKLTAGE-------ACAQGLVTEVFPDSTEVWTRLKAFAKLPPN 206
51 -9.040d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}  ali model 3D-neighbors follow..  13  8...................................................................................................RVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEGFYLREIPLDKGVAGVRDHF--MIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCAWHTI-DTATSYSLARIVGMRRAMELMLTNRTLYPEE-------AKDWGLVSRVYPKD-EFREVAWKVARELAA 204
52 -9.020d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}  ali model 3D-neighbors follow..  12  22...........................................................FDLKGESVNKFNRLTLNELRQAVDAIKADASVKGVI------------VSSGKDVFIVGA-------------------------ITEFVENFKLPDAELIAGNLEANKIF---SDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGL--PEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAED--ALKVSAVDAVVTADAAALDLIKRAIS.... 207

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.