Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: d3gv7b2 d.240.1.1 (B:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst QSFSEEDSFKKCSSEVEAKNKIEELLASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMVNVKMPFHLTLLSVCFCNLKLast
1 -68.900d3gv7b2 d.240.1.1 (B:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1QSFSEEDSFKKCSSEVEAKNKIEELLASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMVNVKMPFHLTLLSVCFCNLK 115
2 -46.400d1t94a1 d.240.1.1 (A:411-515) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  4KSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVN----FEVKTRASTVSSVV---------STAEEIFAIAKELLKTEIDADHPLRLRLMGVRISS.. 105
3 -38.300d1jiha1 d.240.1.1 (A:390-509) DNA polymerase eta {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  4KSMMSNKNLKSCNSIVDCISWLEVFCAELTSRIQDLIVIPRTVSISLKTKS----YEVYRKSGPVAYKG-------INFQSHELLKVGIKFVTDLDIKGKNYPLTKLSMTITNFD 118
4 -37.800d1jx4a1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}  ali model 3D-neighbors follow..  11  3KSIGRIVTMRNSRNLEEIKPYLFRAIEESYYKLDKRI--PKAIHVVAVTED----LDIVSRGRTFPHGI---------SKETAYSESVKLLQKILEEDERK--IRRIGVRFSKF. 100
5 -33.500d1unnc1 d.240.1.1 (C:243-351) DNA polymerase IV {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  1..VGVERTMEDIHHWSECEAIIERLYPELERRLAKVKPLIARQGVKLKFDD----FQQTTQEHVWP-----------RLNKADLIATARKTWDERRGGR---GVRLVGLHVTLLD 98
6 -5.800d1xdna_ d.142.2.4 (A:) RNA editing ligase MP52 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}  ali model 3D-neighbors follow..  10  1.....QSDFSPYIEIDLPSESRIQSLHKSGLAVACEKVHGTNFGIYLINQGDHEVVRFAKRSGIMDPNENFFGYHILIDEFTAQIRILNDLLKQKYGLSRVGRLVLNG....... 107
7 -5.440d1qkra_ a.24.9.1 (A:) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  60GSGNKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSV.................... 154
8 -5.410d1pqsa_ d.15.2.2 (A:) Cell division control protein 24, CDC24, C-terminal domain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  14.....................FDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY.............................. 77
9 -5.110d2c5sa2 d.308.1.1 (A:3-173) Thiamine biosynthesis protein ThiI, N-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}  ali model 3D-neighbors follow..  12  62ERLKDVFGIHKFNLAMKVPSELEDIKKGALAAFLQVKGDVKTFKITVHRSYKHFPMRTMELLPEIGGHILENTEDITVDVHNPDVNVRVEIRSG..................... 155
10 -5.020d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  115YKIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEITKQDIKVAMC................................................................... 162

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;