current user: public

If you have questions about the server, please let us know.

Query: d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQFLast
1 -101.000d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors  100  1TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQF 250
2 -89.000d3oc7a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}  ali model 3D-neighbors follow..  22  5VDYAGPAATGGPVARLTLNSPHNRNALSTALVSQLHQGLRDASDPAVRVVVLAHTGGTFCAGADLSEAGSGGSPSDMAVERAREMAALMRAIVESRLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSFALTEARIGVAPAIISLTLLPKLSARAAARYYLTGEKFDARRAEEIGLITMAAEDLDAAIDQLVTDVGRGSPQGLAASKALTTAVLERFDRDAERLAEESARLFVSDEAREGMLAFLEKRS. 258
3 -88.100d4k3wa_ c.14.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}  ali model 3D-neighbors follow..  22  1.CETLILEKQGPTLVITINRPDVRNAMSLQMVAELSTIFSEIEDISIRAAVLRGAGGHFCAGGDIKDMAGARSQKAGEGKLNRAFGQMIQQVNESSKVVIAITEGAVMGGGFGLACVSDLAIAGPTAKFGMPETTLGVIPAQIAPFVVERIGLTQARRLALLGLRIDATEACKLGIVHQVAESEEQLLNQALERVRLCAPDATAETKALLHRVHEAMAGLLDDAAEKFAAAIRGPEGAEGTMAFMQKRE. 259
4 -87.900d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  21  1..SDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAIDTNVRVIVLKANGKHFSAGADLTWMQSMANFTEENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLGLIPAVISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLTLKYASQISNNAPEAVKNSKQLAQYVANK-EELVRYTASLIAHKRVSDEGQEGLKAFLNKEI. 253
5 -86.200d3rrva_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  19  4.PTEIDVRADGALRIITLNRPDSLNSVNDDLHVGLARLWQRLTDPTARAAVITGAGRAFSAGGDFGYLKELSADADLRAKTIRDGREIVLGMARCRIPVVAAVNGPAVGLGCSLVALSDIVYIAENAYLADPHVQVGLVAAGGPLTWPLHISLLLAKEYALTGTRISAQRAVELGLANHVADDPVAEAIACAKKILELPQQAVESTKRVLNHLERAVLASLDYALSAESQSFVTEDFRSIVTKLADKN.. 253
6 -85.800d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  19  1.HPHLNANLEGGVLTLAINRPEAKNALYGELYLWIAKALDEADNKDVRVVVLRGAEHDFTAGNDMKDFMGFVQNPNAGPAGQVPPFVLLKSAARLSKPLIIAVKGVAIGIGVTILLQADLVFADNTALFQIPFVSLGLSPGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVEDAYATAQATAQHLTALPLASLKQTKALMKHDLDQIIECIDHEAEIFMQRVQSPEMLEAVQAFM..... 246
7 -85.600d3myba_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  22  1EPLLLQDRDERGVVTLTLNRPQAFNALSEAMLAALGEAFGTLADESVRAVVLAASGKAFCAGHDLKEMRAEPSRE-YYEKLFARCTDVMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVSGINVGLFCSTPGVALSRNVGRKAAFEMLVTGEFVSADDAKGLGLVNRVVAPKALEIEAMVSKIVAKPRAAVAMGKALFYQIETDIESAYADAGTTMACNMMDPSALEGVSAFLEKRR. 252
8 -84.600d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  20  2....IGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGTAFCAGADLSGDAFA-------ADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLADAQ--AWAAEIARLAPLAIQHAKRVLND-DGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRP. 237
9 -84.500d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  20  4RTGRISVAIADGVASVEISNLAQRNALTKDMCLEIQELMPQLDDPDVAVVVLRGAGDTFCAGASISELASVLLDPQPDGSTADHLSRADSAIAALSKPAVALVDGACMGGGWQIASACDFIIANERAVIGLTPAKIGIIYPPGLERLVRLVGHANAKYILLTGQTFSAPEARALGLVADVVPSESFECAALVRSLRSRSRFSMHSMKRLVDTDSVPAAGIDQEWAAAWSAMPDSPDMGIGISAFLNREQ. 257
10 -84.500d3tlfa_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  24  2SFDTIKYEVDGHTATITLNRPDALNALSPHMITELRAAYHEAEDDRVWLLVVTGTGRAFCSGADVKEIPEDGKVIYERPDQWEAPQEGTPPFRTMAKPVLTAVNGICCGAGMDWVTTTDIVIASEQATFFDPHVSIGLVAGRELVRVSRVLPRSIALRMALMGERMSAQRAYELGLISEIVEHDRLLAHEIADIVNSNAPLAVRGTRLAIKGLNVPLHEAEILAETFRERVLRTEDAAEGPRAFVEKRQ. 261
11 -83.900d3swxa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 36809]}  ali model 3D-neighbors follow..  20  1DYETLRIRRDGYVLVIGLNRPAKRNAFDKTMLEELALALGEYEDTDLRAAVLYGEGPLFTAGLDLASVAAEIQGGASLTP-EGGINPWQVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQLEVNRGIYPFGATIRFPRTAGWGNAMRWMLTADTFDAVEAHRIGIVQEIVPVGEHVAIAIAQTIARQAPLGVQATLRNARAVREGDAAAEEQLVPTVRELFTSEDATLGVQAFLSRTT. 253
12 -83.500d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  16  2..LPIRLDIAAPLAEIVLNKPERRNALSVDMWAAIPGLVAEANNPDVKLILIHGGDGAFAAGADISEFETIYATEDAAKASGQRIAQALDAIENSEKPVIAAIEGACVGGGVSLAMAADLRVAGEGAKFGVTPGKLGLVYPGDTRRLLAAVGPGATKDILFTGRIFTAGEAKSLGLIDRLVEKGTALARVWAGEIAAISQWSVRATKRMIRGLQTGWTDETPEAQSLFLNGFANEDFKEGYRAFLDKRP. 253
13 -83.300d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  21  2...AIKSTSEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENPEIRSVVITGEGAVFCAGGNLQRLQANRREAPEVAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMSYSTVGLSPDGGSWSLARSLPRALASELLMGGERISAQRLHDLGLVNKVASAGDALALRMAGQLNARAPNALASIKELINASSNTLSQQLACERDHFVRNLHHSNGGEGIAAFLGKRT. 253
14 -83.300d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}  ali model 3D-neighbors follow..  20  1.MDTLDFEVVNNVGWIRMNRAAKHNPFDAELRADLMTVLERVRDADIRVLVLTSHPGSFCAGGNLHVLRDNLDSGPAYQQRIKTGLRFIHDMLNLGRPVIAAVDGPAFGAGFALSLTADIVLASPRARFSMAYLRLGLVPDGALYLLPRAVGLQRAKELMFSTRELDAEEAHRLGLVMEVHESEALEAREIAESLVQAAPTALALTKAALNSLDSDEQTMFSLEAASQAAAFSTKEPRAAIEALLSKQP. 254
15 -83.100d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  13  2..ELVLSHVEGGVQVVRMNRPDKKNALIGEMYAALAEAFAKGEDDDVNVFLILGSQTDFSAGNDLPDFLTWEALS------GSVADRFIRAVAGARKPVVAAVRGAAIGIGSTLLPHCDLVYAAPGTRFHMPFINLGIVPEGSSQTMPALAGHRRAAEMLMLGEPFGVDTAEAVGLINGVVPGEDLEAMAAARKLAAKPRSILVQIKALMKTPAEPIMDRLTREAAVFDTCLKGEALNEAVSAFKEKRA. 246
16 -82.800d4f47a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  19  2..PDALVEQRGHTLIVTMNRPSRRNALSGEMMQIMVEAWDRVDDPDIRCCILTGAGGYFCAGMDLKAATKKPPGDSKDGSYDPSRIDALLKGRRLKKPLIAAVEGPAIAGGTEILQGTDIRVAAESAKFGISEAKWSLYPMGSAVRLVRQIPYTVACDLLLTGRHITAAEAKEMGLVGHVVPDGQALALEIAEIIAANGPLAVQAILRTIRTEGMHENEAFKIDTRIGIEVFLSDDAKEGPQAFAQKRK. 254
17 -82.700d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  20  3....VEIERRGDASLIVLSRPEKLNAINLEMLADLADQFSKAEKEDTRVIVITGYGKNFSAGADINMLASFDPA--SAYSFRLKMNSIAQRIRKSDKPVIALLKGYSMGGGLELAESADIRIAMSDAVIGQPESSIGINAGGGNVILPKLVGRGSAAYLAMSGKKLNAQEAMALGLVDEVVDDEA-KAWKIIDDICKKPKKTLQFIKRAINSYDMGLESAMDQEALYFSLLFTDPEVLDALSKWRK.... 243
18 -82.700d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  16  6FHDRVSVTIEDHVAHVLLDRADKMNALDDAMFEGIVAAGHHLHVKGVRCVVLSGAGRSFCAGLDLSSMGRTDRWSGNSHGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVMEVKWGLVPDAGYALWRGNVRDDVLRELTYTHREFSGEEAVRFGFATHVADDPLAGAMELARVVAEKSPNAVRGAKTLSNAPDLTVDDVLMAESIAQHELMYSRNQMEAVKAGMEKRA. 262
19 -82.600d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}  ali model 3D-neighbors follow..  19  2.YEAIGHRVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEDDSVGAVMITGAEDAFCAGFYLREIPLDKGVADHFRIAALWWHQMIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCAWHTIGIGNDATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFRAWKVARELAAAPTHLQVMAKERFHGWMQPVEECTEFEIQNVIASVTHPHFMPCLTRFLDGHR. 257
20 -82.400d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  24  2TYTTIATSRVAGVGLIRLDRPDALNALNQTLEAEVLDAARDFDDLEIGAIVVTGSERAFAAGADIAEMVTLTPHQ----ARERNLLSGWDSLTQVRKPIVAAVAGYALGGGCELAMLCDLVIAADTARFGQPEITLGILPGGGTQRLTRAVGKAKAMDLCLTGRSLTAEEAERVGLVSRIVPAADLLALAVAQRIARMSRPAGRAVKDAINAFERPLSAGMRYERDAFYAMFDTHDQTEGMTAFLEKRT. 252
21 -82.400d3gowa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  19  2....VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEDREVRALLLTGAGRAFSAGQDLTEFGDRKP---DYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMALSLAKELAQGPTRAYALTKKLLLTYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRP. 248
22 -82.000d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  19  3PVAGLDVTLSDGVFSVTINRPDSLNSLTVPVITGIADAMEYAADPEVKVVRIGGAGRGFSSGAGISADDVSDGGGVPPDEIILEINRLVRAIAALPHPVVAVVQGPAAGVGVSIALACDVVLASENAFFMLAFTKIGLMPDGASALVAAAVGRIRAMQMALLPERLPAAEALAWGLVTAVYPADEFEVDKVIARLLSGPAVAFAKTKLAINATLTELDPALQREFDGQSVLLKSPDFVEGATA....... 250
23 -81.800d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  18  2...SLRLERDGAVARLLIDRADRRNAFSLDMWQRLPELLAEASDDALRVLVVKSANGAFCAGADIAELLANKDDAAFHAANQQAINRAQYELARFRLPTVAMVEGDCIGGGCGIALACDMRIAAPAARFGITPAKLGLVYPHDVKLLVDLVGPGQARRLMFTGGLIDANEAHRIGLVELLGESEDA----LVGQLATVSSFSTQAIKSFVRRVLDGQVADDADSLRVFASAFEGADFREGTGAFLEKRP. 246
24 -81.700d3peaa_ c.14.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}  ali model 3D-neighbors follow..  20  2.LKFLSVRVEDHIAVATLNHAPA-NAMSSQVMHDVTELIDQVEDDNIRVVVIHGEGRFFSAGADIKEFTSVTEAK-QATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKLGLPELTLGLIPGAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAEETFLTLKVAKQIAGKSPATARAVLELLQTKSSHYYEGVQREAQIFGEVFTSEDGREGVAAFLEKRK. 252
25 -81.400d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  20  1..ADIDFRIEGHVAHVRLNRPQGLNAITQEMDDLLLDAWTEVNNSDIWAVVLSAEGKAFCIGADVSGGAERKTRM----ALGGGLTGIGGPLVTCKKPMVAAVQGFCVGGGFELAMCADIIVAADTAQFGLPETKVGIIGEGVVHRAMRQLPYHIALQLILTGERIKADEARHYGLVNEVVPFAELEALRWASKLNAASPLAVQAAKAAALRLGHPLEVALMTRFEPIEEYAATEDKKEGERAAGERRK. 249
26 -81.200d4qiia_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  17  21TDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARSPDVGVVLLTGNGWAFCSGGDQRIRGRSGYQYASGRAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASEYARFKQTDADVGSFDGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELEGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRP. 290
27 -81.100d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  21  7RYPGLAFAWRPGVLEITF-RGEKLNAMPPALHRGLARVWRDLEVEGVRAVLLRGEGGVFSAGGSFGLIEEMRASHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGVAAGHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYALEVAERLAQGPKEALHHTKHALNHWYRSFLPHFELSLALEFLGFSGKELEEGLKALKEKRP. 259
28 -80.900d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1RYRDIVVRKQDGFTHILLSKSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTVMVRIKELASCNPVVLEESKALVRNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKI. 256
29 -80.600d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  19  2..PEFKVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSRDVRAVVITGAGKAFCAGADLKERATMAED--EVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGLTEVKLGIIPGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAYGLAESVVENAPIAVATAKHAIDGTGLELDDALALELRKYEEILKTEDRLEGLRAFAEKRA. 252
30 -80.600d3qxza1 c.14.1.0 (A:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}  ali model 3D-neighbors follow..  17  1..TELHEEIRDGVAVLTLHGPSTRNSFTVELGRQLGAAYQRLDDPAVRVIVLTGAPPAFCSGAQISAAAETFAAPR---NPDFSASPVQPAAFELRTPVIAAVNGHAIGIGMTLALHADIRILAEEGRYAIPQVRFGVAPDLAHWTLPRLVGTAVAAELLLTGASFSAQRAVETGLANRCLPAGKVLALRMAHDIATNAPESAALTKRLLWDTGMSAAEVAARETADHLRLMGSQDAAEGPRAFIDGRP. 252
31 -80.300d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  15  2.SDVIQLVREGAIATVTLNRPDRMNALNLPMWRGLAEAFETISDRSIHVVILRGAGKAFAPGADIEEFDTLRANAEQAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGLELACCCDIRLSAKSGKFGVPINKISVVMAPELAQIRRVAGPAAALEILLEGRIMDADEAAAKRLVNRVVEDDAMDVAATAKRIAAGAPLANRWHKAFIARL-DDPTPVSEAELDECYRFLDTKDYAEGLAAFRAKRK. 253
32 -80.200d4k29a_ c.14.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  20  1TYSKILYETLHGVARITLNRPERTNALDQEMLGEINAAMDAAEDAGVKAVIVRGAGNAFSSGFDLKAQMEARPAGVDARPLLRKDFDTVMRFWHCPKPTIAAVRGPCLAGACELALACDMTIATEDAFFGEPELKFGA--GIVVMLLPWIVGPKIAKEIILLGERVPARRAAEIGMVNRVVDGDGLDALRIARHIGAIDPGLVKETKRALNESALEIDLAIEGAGSPDKIAFFEVARRDGLRAAIAWRD. 264
33 -79.400d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  22  5RWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLRTIELARNLLEKNPVVLRAAKHGFKCRELTWEQNEDYLYAKLDQSRLLD............... 247
34 -79.200d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  2SYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPERCIILRAPSGKVFSAGHDIHELPSG---GRDPLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELETLQMAHHISEKAPLAIAVIKEELREAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFLEKRK. 255
35 -77.700d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  21  5GYSNLDLDLDNGVCVVTLNRPDKRNALDVATIEELVTFFSTAHRKGVRAVVLTGAGDHFCAGLDLVEHWKADRSADDFMHVCLRWHEAFNKMEYGGVPIIAALRGAVVGGGLELASAAHLRVMDQSTYFALPEGQRGIFTGGATIRVSDMIGKYRMIDMILTGRVYQGQEAADLGLAQYITEGSSFKAMELADKIASNLPLTNFAICSAISMQNMSGLDAAYAEAFVGGIVNTQPAA............. 245
36 -77.400d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  22  1AYESIQVSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGDRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNALAADISSKSPVAVQGSKINLISRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKD. 266
37 -76.700d5e0nx_ c.14.1.0 (X:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  24  1TRFVLLDRSRPGVALVTLNRPERMNSMAFDVMVPLLELLGDLRDNSVRVVILTGAGRGFSSGADHKSAGSVPHVDTYALRSMEVLDNVILALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYFRAAGINNGLTASGLSYLLPRAIGTSRAFEIMLTGRDVDAAEAERIGLVSRTVPDDDLLCFEMAQRMRGFSRPGIELTKRTLWS-AASLEGHMQAE.......................... 236
38 -76.400d2ppya_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}  ali model 3D-neighbors follow..  19  6KKQYLTVFKEDGIAEIHLHINK-SNSYDLEFYKEFNAAIDDIRDPDIKVVIVMSDVKFFSAGADINFLRSADPR--FKTQFCLFCNETLDKIARSPQVYIACLEGHTVGGGLEMALACDLRFMGDEAKIGLPEVSLGVLAGGGTQRLARLIGYSRALDMNITGETITPQEALEIGLVNRVFPQAETRTREYARKLANSATYAVSNIKLAIMGKEMPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQ. 258
39 -75.500d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  18  2..EPVRIERNGPVTTVIIDRPEARNAVNGPTAAALFAAFEEFDDDTASVAVLTGANGTFCAGADLKAFGTPEANQ----VHREGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVVDEDATMGVFCRRWGVPLIGGTVRLPRLIGHSRAMDLILTGRAVDAAEAYAIGLANRVVPTGQARAEELAADLARLPQQCMRADRLSAHQWGESENAAMDFEFASI...................... 228
40 -75.400d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  17  2....VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANDDSVRAVVVYGGARSFSAGGDFNEVKQLSR-SEDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLAITQAHVMASYPASAFINTKRAVNPFIHLLEQTRDASKAVHK..................... 230
41 -75.200d2q35a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}  ali model 3D-neighbors follow..  17  3....QLTELGNGVVQITMKDESSRNGFSPSIVEGLRHCFSVVANQQYKVVILTGYGNYFSSGASKEFLIRKTRGEVE-------VLDLSGLILDCEIPIIAAMQGHSFGGGLLLGLYADFVVFSQESVYATNFMKYGFTPVATSLILREKLGSELAQEMIYTGENYRGKELAERGIPFPVVSRQDVLAQQLGQKIAKSPRLSLVALKQHLSDIKAKFPEAIKKELEIHQVTFNQPEIASRIQQEF..... 241
42 -74.500d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}  ali model 3D-neighbors follow..  15  1...DVLFSNHGRVAVITLNRPERLNAWTTPMRETIIDALERFNDPEVAAIIMTGAGRAFSAGQDLSEAHDF--DGERAVAWVKEWQRYYTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRMGQPEINAGIASTTGPWIMNAMLGMSRTIELTLTGRLMEAEECHRIGLIHHLVDEDKVFALEIATELAAKPPVAMRLDKQRFRMTEPGFIDCIEAGERI....................... 227
43 -74.500d3h0ua1 c.14.1.0 (A:8-283) automated matches {Streptomyces avermitilis [TaxId: 33903]}  ali model 3D-neighbors follow..  19  3SYETIKARLDGTVLSATFNAPP-MNLIGPEVVRDLVALLEELAPTAPRVVIFDSADDFFFPHVDMTKVPEYTAEAAKAGPGDASLGMLFRKLSQLPAVTIAKLRGRARGAGSEFLLACDMRFASENAILGQPEVGIGAPPGGAIQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNRAVPDAELDVAGIAARMSGFPRDALIAAKSAINAISLPAPAEVRADAALFQQLVRGEKVQQRTAELFKQGF. 257
44 -74.400d3pe8a_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  23  2..PVLLVDTTDRVRTLTLNRPQSRNALSAELRSTFFRALSDAQDDDVDVVIVTGADPVFCAGLDLKELGDTTELP-----------DISPKWPDMTKPVIGAINGAAVTGGLELALYCDILIASENAKFADTHARVGLMPTGLSVRLPQKVGVGLARRMSLTGDYLSAQDALRAGLVTEVVAHDDLLARRVAASIVGNNQKAVRALLDSYHIDALQTGGALWAEAEAARQWMRST............... 228
45 -74.400d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1GFETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQVWTRLKAFAKLPPNALRISKEVIRREREKLHAVNAEECNVLQGRWLSDECTN........... 245
46 -72.800d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  20  10QRPLSQDGTTQGGTVATLTLAAKMGSMGPAFWQEFPQALS--ELGDARVLIVRGE-QVFSAGLDVKSNGAAIGKPDAFKAVVDEMHAVTEGLAALPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLPEVKLGITADGGLQRLPHLIGRGRTAHLALTGEAIDAATAERWGLVTEVLPDQDALFAALAEHLAALPAKALEGTKRALSD-GLPHAESLAAAVRWNAEHMTVEALQAG.......... 253
47 -68.400d1hnua_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  2..EKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADNRDVYFTIIQSSGRFFSSGADFKGIAKAQGDDTNKSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSNDKVYLLYPFANLGLITGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSVLEELREKVKGLYLPSCLGMKKLLKNHIDAFNKANSVEVNESLKYWVDGEPLK---RFRQ.... 263
48 -67.900d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  18  2QRVLVEPDAGAGVAVMKFKNPPV-NSLSLEFLTELVISLEKLEDKSFRGVILTSDRGVFSAGLDLTEMCGRSP--AHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAPWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQALSAIAQWMAIPDHARQLTKAMMRATASRLVTQRDADVQNFVSFISKDSIQKSLQ........ 248
49 -65.800d2j5ga_ c.14.1.0 (A:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}  ali model 3D-neighbors follow..  14  7KYENLHFHRENGILEVRMHTNGSSLVFTGKTHREFPDAFYDISDRDNRVVILTGSGDAWMAEIDFPSLGDVTN-PREWDKTYWEGKKVLQNLLDIEVPVISAVNGAALLHS-EYILTTDIILASENTVFDMPHLNAGIVPGGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMAWEIARTLAKQPTLNLRYTRVALTRLKRLVNEGIGYGLALEGITATDLR.............. 247
50 -58.400d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}  ali model 3D-neighbors follow..  16  4EGKAITVTAESGIVELKFDLKESVNKFNRLTLNELRQAVDAIKDASVKGVIVSSGKDVFIVGADITEFVENFKLPDAEIAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGLPEVKLGIYPGGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAAVAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSASNCLIGLFLNDQE. 299
51 -12.900d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  12  106............VYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCS-----GVEFPNQDKVYPNRRGGGTPFFRNS----ELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVG----GILSGMNPKGYIDDEAAEQIIAAQIENSKLKVPAYDETGFFREVYQNDLGVIDGIKKYISYLPA.................................................. 289
52 -12.300d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  14  91............VHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSG-----GARIQEGIDSLSGYGKMFFANVKLSGVV--------PQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFIT-----------GPQVIKSV----------TGEDVTADEMAISGNIHFVAEDDDAAELIAKKLLS...................................................... 247
53 -11.200d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  98............VVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASG-----GARMQE-------ALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSSFAMLGDLNIAEPKALIGFA----------GPRVIEQTVREKLPPGF-------RSEFLIEKGAIDMIVRRPEMRILAKLMNLPAPNP.................................................. 263
54 -10.000d2f9ia1 c.14.1.0 (A:1-314) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  11  104..RAVTVIGQQRGKDTKDNIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDT-----KGAYPG-------KAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSV-------------------ISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLGIIDDVISEPLGGAHKDIEQQALAIKSAFVAQLDSLESLSRDEIAN--DRFEKFRNIGSYIE.... 314
55 -9.040d2f6ia1 c.14.1.1 (A:179-366) Clp protease, ClpP subunit {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}  ali model 3D-neighbors follow..  23........................DEINKKTADELISQLLYLDNINHNDIYINSPGGSINEG-----------------------LAILDIFNYIKSDIQTISFGLVASMASVILASGK-RKSLPNCRIMIHQPLGNALKKLLYHYLSSFTNQTTIEKDSDRDYYMNALEAKQYGIIDEVIETKLPHPY............................................................. 186

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.