current user: public

If you have questions about the server, please let us know.

Query: d3hpya2 d.32.1.0 (A:147-289) automated matches {Pseudomonas sp. [TaxId: 237609]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst IAPIQLDHCLLYGPNIAEVQKIFTEVLGFYLVERVLSPDGDSDMGIWLSCSHKVHDIAFVEYPEKGKLHHCSFLLESWEQVLRAGDIMSMNEVNVDIGPTRHGVTRGCTIYAWDPSGNRFETFMGGYHPYPDYEPLSWTYDNFLast
1 -82.100d3hpya2 d.32.1.0 (A:147-289) automated matches {Pseudomonas sp. [TaxId: 237609]}  ali model 3D-neighbors  100  1IAPIQLDHCLLYGPNIAEVQKIFTEVLGFYLVERVLSPDGDSDMGIWLSCSHKVHDIAFVEYPEKGKLHHCSFLLESWEQVLRAGDIMSMNEVNVDIGPTRHGVTRGCTIYAWDPSGNRFETFMGGYHPYPDYEPLSWTYDNF 143
2 -67.200d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]}  ali model 3D-neighbors follow..  21  7.GDQGIGHFVRCVPDTAKAMAFYTEVLGFVLSDIIDIQMGPETPAHFLHCNGRHHTIALAAFPIPKRIHHFMLQANTIDDVGYAFDRLDAAGRIT-SLLGRHTNDQTLSFYADTPSPMEVEFGWGPRTVDSSWTVARHSRTAM 150
3 -62.800d2ehza2 d.32.1.0 (A:138-302) automated matches {Pseudomonas sp. [TaxId: 69011]}  ali model 3D-neighbors follow..  21  8TGDQGLGHCIVRQTDVAEAHKFY-SLLGFRGDVEYRIPLPNGMTLSFMHCNARDHSIAFGAMPAAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDIALQLGIHANDKALTFYGATPSGWLIEPGWRGATAIDEAEGDIFGHGV. 153
4 -59.600d3hpya1 d.32.1.0 (A:2-146) automated matches {Pseudomonas sp. [TaxId: 237609]}  ali model 3D-neighbors follow..  13  3TGVLRPGHAQVRVLNLEEGIHFYRNVLGLVETGR------DDQGRVYFKCERDHSCYIIREADT-AGIDFFGFKVLDKATLEKLDADLQAYGLTTTRIPAGEMLETGERVRFELPSGHLIELYAEKTCVGNGVNPAPWNAQR. 142
5 -56.700d4ghga1 d.32.1.3 (A:3-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}  ali model 3D-neighbors follow..  15  11PDILRCAYAELVVTDLAKSRNFYVDVLGLHVSYE-------DENQIYLRSFEEHHNLVLTKGPV-AALKAMAFRVRTPEDVDKAEAYYQELGCRTERRKDGFVKGIGDALRVEDPLGFPYEFFFETTHVERLMRYDLYS.... 144
6 -56.500d4ghga2 d.32.1.3 (A:148-358) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}  ali model 3D-neighbors follow..  26  2.ELVRLDHFNQVTPDVPRGRKYL-EDLGFRVTEDIQDDEGTT-YAAWMHRKGTVHDTALTGGNG-PRLHHVAFSTHEKHNIIQICDKMGALRISDERGPGRHGVSNAFYLYILDPDNHRIEIYTQDYYTDPDNPTITWNVHD. 142
7 -55.100d2ehza1 d.32.1.0 (A:4-137) automated matches {Pseudomonas sp. [TaxId: 69011]}  ali model 3D-neighbors follow..  15  2AAVIELGYMGISVKDPDAWKSFATDMLGLQVLDE------GEKDRFYLRMDYWHHRIVVHHNGQD-DLEYLGWRVAGKPEFEALGQKLIDAGYKIRICDKVEAQERMVLMKTEDPGGNPTEIFWGPRIDMSN........... 128
8 -53.600d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]}  ali model 3D-neighbors follow..  12  1.SIERLGYLGFAVKDVPAWDHFLTKSVGLMAAGS-------AGDAALYRADQRAWRIAVQPGELD-DLAYAGLEVDDAAALERMADKLRQAGVAFTRGDEALQRKVMGLLCLQDPFGLPLEIYYGPAEIFHE........... 125
9 -53.000d2zyqa1 d.32.1.0 (A:2-132) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  14  1.SIRSLGYLRIEATDMAAWREYGLKVLGMVEGKG------APEGALYLRMDDFPARLVVVPGEHD-RLLEAGWECANAEGLQEIRNRLDLEGTPYKEATAAELARVDEMIRFADPSGNCLEVFHGTALEHRR........... 126
10 -44.200d1xqaa1 d.32.1.2 (A:1-112) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  16  1...MGIKHLNLTVADVVAAREFLEKYFGLTCSGT-------RGNAFAVMRDNDGFILTLMKGKEVPKTFHVGFPQESEEQVDKINQRLKEDGFLVEPPKH----AHAYTFYVEAPGGFTIEVMC................... 112
11 -42.900d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  13  2YEIKGHHHISMVTKNANENNHFYKNVLGLRRVKMTVNQDDPSMYHLFYGDKTGSPGTELSTYRGTNAITRIGLLVPSEDSLHYWKERFEKFDVKHSEMTTY---ANRPALQFEDAEGLRLVLLVSNGEKVEHWET........ 142
12 -41.500d2p7oa_ d.32.1.2 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}  ali model 3D-neighbors follow..  14  2..ISGLSHITLIVKDLNKTTAFLQNIFNAEEIYSSGDKTFSLSKEKFFLIAGLWICIMEGDSLQERTYNHIAFQI-QSEEVDEYTERIKALGVEMKPERPRV-QGEGRSIYFYDFDNHLFELHAG.................. 122
13 -41.400d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  14  8HQIQGMGSVELTVRRLDKMASTLTEIFGYTEVSR------NDQEAIFQSIKGEAFGEIVVKYLDRGSIHHLAIRVKNDAELAYWEEQVKQRGFHSSGIIDR---FYFKSLYFRESNGILFEIATDGPGFTVDGDVEHLGEK.. 146
14 -39.600d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  1...MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYK--SLAFVGYGPETEEAVIEKYELGTAYGHIALSV---DNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIEL..................... 123
15 -37.700d4naza1 d.32.1.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 158879]}  ali model 3D-neighbors follow..  15  1..LKSINHICFSVRNLNDSIHFYRDILLGKLLLT-------GKKTAYFELAGLWIALNEEKDIPRNSYTHIAFTI-DDSEFKYWHQRLKDNNVNILEGRVRD-IRDRQSIYFTDPDGHKLELHTG.................. 118
16 -36.700d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  20  2..LTGLNHLTLAVADLPASIAFYRDLLGFRLEAR-------WDQGAYLELGSLWLCLSREPQYGGPDYTHYAFGI-AAADFARFAAQLRAHGVREW----KQNRSEGDSFYFLDPDGHRLEAHVG.................. 114
17 -36.600d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  10  7..QAAQIRIARPTGQLDEIIRFYEEGLCLKRIGEFSQHNGYD--GVMFGLPHADYHLEFTQAPVPHPDSLLVFYVPNAVELAAITSKLKHMGYQEVESENPY--WSNGGVTIEDPDGWRIVFM.................... 129
18 -35.100d3vw9a_ d.32.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  19TKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDGFGHIGIAV---PDVYSACKRFEELGVKFVKKPDD--GKMKGLAFIQDPDGYWIEI..................... 166
19 -32.300d3rmua1 d.32.1.0 (A:45-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1..LGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPE-HGVSVVFVNLGNTKMELLFLQKNKAGGMHHICIEV---DNINAAVMDLKKKKIRSLSEEVKIGAHGKIFLHPKDCGGVLVEL..................... 129
20 -31.700d1ss4a1 d.32.1.6 (A:1-148) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]}  ali model 3D-neighbors follow..  10  6..LLRMDNVSIVVESLDNAISFFEE-IGLNLAGRVTGLGSQCVEIAMMVTPDGHSRIELSRFLTPPGYLRVMFTV---EDIDEMVSRLTKHGAELVGEVVQYENSYRL-CYIRGVEGILIGL..................... 143
21 -31.600d1jc5a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]}  ali model 3D-neighbors follow..  15  5..FICIDHVAYACPDADEASKYYQETFGWHELHREENPEQGVVEAAKLTEHMTQVQVMLAKHNGRAGLHHMAWRV---DDIDAVSATLRERGVQLLYDEPKLGTGGNNFMHPKSGKGVLIEL..................... 140
22 -30.800d3oa4a1 d.32.1.0 (A:5-139) automated matches {Bacillus halodurans [TaxId: 272558]}  ali model 3D-neighbors follow..  14  1.KSNKLDHIGIAVTSIKDVLPFYVGSLKLKLLGMEDLPS-QGVKIAFLEIGESKIELLEPLSEESPGIHHIAIGV---KSIEERIQEVKENGVQMINDEPVPGARGAAFLHPRSARGVLYEF..................... 129
23 -30.300d3hdpa_ d.32.1.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}  ali model 3D-neighbors follow..  10  4..SLKVHHIGYAVKNIDSALKKFKRLGYVEESEVVRDEV-RKVYIQFVINGGYRVELVAPDGEDSPTPYHICYEV---EDIQKSIEEMSQIGYTLFKKAEAPAIDNRKVAFLFSTDIGLIEL..................... 129
24 -29.100d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]}  ali model 3D-neighbors follow..  11  1...ARISLFAVVVEDMAKSMEFYRK-MGVEIPAEADSAPDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQ-RYAIVKDPDGNVVDLFAPL................. 127
25 -26.700d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}  ali model 3D-neighbors follow..  11  1...MNLNQLDIIVSNVPQVCADLEHILDKKADYANDG---------FAQFTIGSHCLMLSQNHLVPL--IIHIEV---EDVDQNYKRLNELGIKVLHGPTVTDWGTESL-LVQGPAGLVLDFYR................... 113
26 -25.900d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  12  1...VRRVVANIATPEPARAQAFYGDILGMPVA-------DHGWIVTHASPLEAHAQVSFAREGGSGT--DLSIEV---DNFDEVHARILKAGLPIEYGPVTEAWGVQRL-FLRDPFGKLINIL.................... 111
27 -25.500d3isqa1 d.32.1.3 (A:9-174) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  7.RFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHVALNPWNKEMGDHLVKHGDGVKDIAFEV---EDCDYIVQKARERGAKIMREPWVDKFGKVKFAVLQTYGDTTHTL..................... 138
28 -23.700d1tfza1 d.32.1.3 (A:15-195) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  11  7FKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLGVRAVAIEV---EDAESAFSISVANGAIPSSPPIVLN-EAVTIAEVKLYGDVVLRY..................... 154
29 -22.900d2rk9a_ d.32.1.0 (A:) automated matches {Vibrio splendidus [TaxId: 314291]}  ali model 3D-neighbors follow..  12  7.........ELYCFDINVSQSFFVDVLGFEVKYERPDEETLDGVDVMLEGIAGKSRKWLSGDLEFPLGSGVNFQW-DVIDIEPLYQRVNESAADSIYLA-GDSIATQKQFMVQTPDGYLFRFCQD.................. 132
30 -21.400d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  5MGLMGFEFIEFASPTPGTLEPIFEI-MGFTKVATHRSKNVRQGEINLILNNEPNSIASYFAAEHGPSVCGMAFRV---KDSQKAYNRALELGAQPIHID--TGPMELNLPAIKGIGGAPLYLIDRFGEGSSIYDI........ 136
31 -21.300d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]}  ali model 3D-neighbors follow..  14  9.........VLTARDVAEAVEFWTDRLGFSRV-------FVEDDFAGVVRDDVTLFISAVQDQVVPDNTQAWVWVRGLDELEVVSTNFRDASGPAMTEIVEQPWGRE--FALRDPAGNCVHFVAE.................. 120
32 -20.600d1tfza2 d.32.1.3 (A:196-408) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  15  3YGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAKRKSQIQTYLEHNEGAGLQHLALMS---EDIFRTLREMRKRSSIGGFDFMPSPPPTYYILVDRDDQGTLLQIFTK.................. 167
33 -19.200d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  11  1AGLKVIDHLTHNVYRMVYWANFYEKLFNFREARYFDIKGEYTGLSKAMSAPDGMIRIPLNEESSKEGIQHVAFLT---DDLVKTWDALKKIGMRFMTAPPDT......................................... 116
34 -19.200d3fcda1 d.32.1.0 (A:4-124) automated matches {Uncultured bacterium [TaxId: 77133]}  ali model 3D-neighbors follow..  11  7.........FLHIPDMQEALTLFCDTLGFELKYRHSNYAYLELSGCGLRLLEEPARKIIPDGIARVAIC---IDVSDIDSLTKLSPALENLPADQVEPLKNMPYGQREF-QVRMPDGDWLNFTAPL................. 120
35 -17.500d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  13  7.........NLPSRDFDSTAAFYER-LGFGIVFRDAG---------WMILQRGDLMLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQERIHAPELQGWGGTMAALVDPDGTLLRLIQN.................. 118
36 -13.000d2q48a_ d.32.1.9 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  11  2LVFTEFKMLLVEAQKVGDAVTFYKSAFGAIESGHSLYPKRDQELPHVLSSELNLAGSSFVVCDVSSLPGFSTAKSEGTKDAEAAVAKAVDAGAVKVEVTEAEVELGFKG-KVTDPFGVTWIF..................... 133
37 -12.100d1u7ia1 d.32.1.7 (A:1-132) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  1MSARVRPFLMFQGVQAEAAMNFYLSLFDLQIQRYGAEGPGPEGSVLKALFRLGDQSVHCIDSHVRHAFDSFFVDCESNAQIERLAEALSDGGKALM--PLGDYGFSQRFAWLADRFGVSWQLNLA.................. 132
38 -12.000d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  1MDIPKITTFLMFNNQAEEAVKLYTSLFEITMAKYGENGPGDPGTVQHSIFTLNGQVFMAIDANSGTELPSLFVTVKDTIEMERLFNGLKDEGAILM--PKTNMPPYREFAWVQDKFGVSFQLALP.................. 128
39 -10.600d3l20a1 d.32.1.0 (A:4-151) automated matches {Staphylococcus aureus [TaxId: 367830]}  ali model 3D-neighbors follow..  14  8..........IAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFG-------------TKEEAQEATMHAEFEVEDADKVEAFYEQIKDHSSIEIELPFADQFWGGKMGVFTDKYGVRWMLHGQDYTAIQ............ 148
40 -9.490d1u6la1 d.32.1.7 (A:4-138) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  12  1....QIVPYLIFNGNCREAFSCYHQHLGGTLEAMLPIPADWKDKIMHARLVVGSFALMASDNHPAYPYESISLNVDSKAEAERLFNALAEGGSVQM--PLGPTFWAASFGMFTDRFGVAWMVNCEQD................ 135

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.