Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: d3mj0a1 b.34.14.1 (A:601-717) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst SMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEELast
1 -75.000d3mj0a1 b.34.14.1 (A:601-717) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors  100  1SMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEE 117
2 -39.500d4krea1 b.34.14.0 (A:18-410) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  208AQPVIEFMCEVLDIRNIDEKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVA 329
3 -12.100d1u04a1 b.34.14.1 (A:1-323) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  152MKTLWELVNKDPKELEEFLMTHKENLDIASPLKTVYKPCFEEY---TKKPKLDHNQEIVKYWYNYHIERYWNTPEAKLEFYRKFGQVDLKQPAILA-IKKNKNYKIYLLPQLVVPT. 271
4 -7.070d2h6ua_ b.3.4.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  18..................................ANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKENFIAETGKYWDALGETCFYPYVEIFTITNTSQHYHVPLLL..... 103
5 -6.660d2g2na_ b.3.4.0 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  17..................................ADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTVFKTGDYFKKQNLESFFPEIPVFHINKVNEHYHVPLLL..... 100
6 -6.520d3bzca5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  12  29.......LLDTATVYPHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKAGELIKKYPGMKLTKIMVSEAGASVYSASELAAKEFPELDAVSIA---RRLQDPLELVKI.. 140
7 -5.930d3qvaa1 b.3.4.0 (A:1-108) automated matches {Klebsiella pneumoniae [TaxId: 272620]}  ali model 3D-neighbors follow..  18..................................EGVTVSLSREGETLANLVTNAQGRIATFSAAPLPAGRYCLTAETGAWFARAGRESVFTRAQID-GEAAEDHFHLPFLI..... 97
8 -5.740d1m0da_ c.52.1.17 (A:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  12  1.......................................................................SGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPVET..... 50
9 -5.490d1a0ia1 b.40.4.6 (A:241-349) ATP-dependent DNA ligase {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  10  22EGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQWGFFSPYG----------IGDNDACTINPYDGWACQISYMEETPDGSLRHPSFVMFR................... 109
10 -5.440d3t6eh2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}  ali model 3D-neighbors follow..  13  102................................................RVATDFSIAEGDVDPRGLPVVAADGVEAVTDLWVDRSEHYFRY----ELSVAGSARTALIPLGFCDVKK 169

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;