current user: public

If you have questions about the server, please let us know.

Query: d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MEFKDFPLKPEILEALHGRGLTTPTPIEAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLAPSQERGRKPRALVLTPTRELALQVASELTAVAPHLKVVAVYGGTGYGKQKEALLRGADAVVATPGRALDYLRQGVLDLSRVEVAVLDEADEMLSMGFEEEVEALLSATPPSRQTLLFSATLPSWAKRLAERYMKNPVLINVIKLast
1 -104.000d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors  100  1MEFKDFPLKPEILEALHGRGLTTPTPIEAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLAPSQERGRKPRALVLTPTRELALQVASELTAVAPHLKVVAVYGGTGYGKQKEALLRGADAVVATPGRALDYLRQGVLDLSRVEVAVLDEADEMLSMGFEEEVEALLSATPPSRQTLLFSATLPSWAKRLAERYMKNPVLINVIK 207
2 -94.600d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  38  3.EFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKK---DNIQAMVIVPTRELALQVSQICIQVSKHAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL.. 206
3 -94.500d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  37  2.QFTRFPFQPFIIEAIKTLRFYKPTEIQERIIPGALRGESMVGQSQTGTGKTHAYLLPIMEKIKPER---AEVQAVITAPTRELATQIYHETLKITKFIVARCLIGGTDKQKALEKLNVQPHIVIGTPGRINDFIREQALDVHTAHILVVDEADLMLDMGFITDVDQIAARMPKDLQMLVFSATIPEKLKPFLKKYMENPTFVHV.. 208
4 -92.000d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  41  14KTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALL---ETPQRLFALVLTPTRELAFQISEQFEALGSSVQSAVIVGGIDSMSQSLALAKKPHIIIATPGRLIDHLENTGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVS. 219
5 -91.400d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  39  1.......MNEKIEQAIREMGFKNFTEVQSKTIPLMLQGKNVVVRAKTGSGKTAAYAIPILE---------LGMKSLVVTPTRELTRQVASHIRDIGRYTKVAEVYGGMPYKAQINRVR-NADIVVATPGRLLDLWSKGVIDLSSFEIVIIDEADLMFEMGFIDDIKIILAQTSNRKITGLFSATIPEEIRKVVKDFITNYEEIEAC. 191
6 -90.300d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  38  10YKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSV---KAPQALMLAPTRELALQIQKVVMALAFHIKVHACIGGTSFVEDAEGLR-DAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV.. 212
7 -90.000d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  34  2.GFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVT---GQVSVLVMCHTRELAFQISKEYERFSKYVKVAVFFGGLSIKKDEEVLKKNCHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLELDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV.. 207
8 -87.300d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  32  2.DFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLEN---LSTQILILAPTREIAVQIHSVITAIGIKLECHVFIGGTPLSQDKTRLK-KCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRL.. 205
9 -84.000d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  36  23TRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQTSTDGLGVLIISPTRELAYQTFEVLRKVGKNFSAGLIIGGKDLKHEAERIN-NINILVCTPGRLLQHMDETSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYVWVHE 232
10 -82.500d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  37  14.SFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQESKREGPYGLIICPSRELARQTHGILEYYCRLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGR 232
11 -81.500d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  40  22...DAFQQYPDLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPEQRNGPGMLVLTPTRELALHVEAECSKYSYGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYV.. 227
12 -81.300d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  32  3.SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNRNMIAQSQSGTGKTAAFSLTMLTRVNPED---ASPQAICLAPSRELARQTLEVVQEMGKFTKQLIVPDSFEKNKQI-----NAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIV.......... 196
13 -81.100d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  37  14.SFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGRRKQYPISLVLAPTRELAVQIYEEARKFSYRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVG. 239
14 -73.300d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  30...QEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANKG--FRALIISPTRELASQIHRELIKISEGFRIHMIHKAAVAAKKFGKSSKKFDILVTTPNRLIYLLKQDPIDLASVEWLVVDESDKLFETGFRDQLASIFLACSHKVRRAMFSATFAYDVEQWCKLNLDNVISVSIG. 239
15 -55.900d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  18  18.LFPEDFLLKEFVE-FFRKCVGEPRAIQKMWAKRILRKESFAATAPTGVGKTSFGLAMSLFLAL------KGKRCYVIFPTSLLVIQAAETIRKYAEKAGIGYYHGRIPKREKENFMQRNFKIVITTTQFLSKHYRE----LGHFDFIFVDDVDAILKLGFHYDLKTKSWVGEARGCLMVSTATAKKGKKAELFRQLLN........ 223
16 -27.300d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  20  1MKVEELSISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGG------KSLYVVPLRALAGEKYESFKKWEKGLRIGISTGDYESRDEH----GDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMNKALRVIGLSATAPN.................... 184
17 -21.300d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  5...EVLNLESGAKQVLQETGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLL------------TVVVSPLISLMKDQVDQLQANG--VAAACLNSTQTREQQLEVMTGQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGFRPEYAALLRQRFPTLPFMALTATADDTTRQ................ 190
18 -20.800d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  20  9......................QPRIYQEVIYAKCKE-TNCLIVLPTGLGKTLIAMMIAEYRLTKYGG-----KVLMLAPTKPLVLQHAESFRRLNLPPEKIVALTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRISLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTASPGSTPEKIME............. 175
19 -20.100d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  17  63......GLVGQIKKFCDNFGYKEPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLARYYLENYEG-----KILIIVPTTALTTQMADDFVDYRSHAMIKKIGGGASKDDKYKNDA---PVVVGTWQTVVKQPKE----FSQFGMMMNDECHLA------KSISSIISGLNNCMFKFGLSGSLRDG................... 265
20 -18.400d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  22  1.................................MLKKGMTTVLDFHPGAGKTRRFLPQILAECARRRL-----RTLVLAPTRVVLSEMKEAFHGLDVKFHTQAFSAHGSGREVIDAMCHAT----------LTYRMLEPTRVVNWEVIIMDEAHFLDPASIAARGWAAHRARANESATILMTATPP..................... 138
21 -14.900d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  20  70......................SLRDYQEKALERWLVDKRGCIVLPTGSGKTH-VAMAAINELST--------PTLIVVPTLALAEQWKERLGIFG----------EEYVGEFSGRIKELKPLTVST---YDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMS-----IAPFRLGLTAT....................... 204
22 -13.900d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  17  7....................................SFQVAHLHAPTGSGKSTKVPAAYAAQ---------GYKVLVLNPSVAATLGFGAYMSK--------AHGVDPNIRTGVRTITTGSPITYSTYGKFL---ADGGCSGGAYDIIICDECHST-DATSILGIGTVLDQAETAGARLVVLATATP.................... 136
23 -13.100d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  12  1.....................................................................GIRFEWVRVDLPEIYKELLREMLRDALKPLAETGLLESSSPDIPKKEVLRAGQIINEEMAKGNHDLRGLLLYHAMA--LKLHHAIELLETQGLSALRAYIKKLYEEAKAGSTKAS---------KEIFSDKRMKKAIS 130
24 -12.700d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  18  4................................PSMLKKKQLT-DLHPGAGKTRRVLPEIVRE-----AIKKRLRTVILAPTRVVAAEMEEALRGLPVRYMTTAV----------VTHSGTEIVDLMCHATFTSRLLQPI-RVPNYNLNIMDEASSIAARGYISTRVE-----MGEAAAIFMTATPPGTRDAFPDS............ 152
25 -12.600d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  19  85........................TNAQKRAHQEIRNDMNRLLQGDVGSGKTVVAQLAILDNYEAG-------QTAFMVPTSILAIQHYRRTVESFSNIHVALLIGATTPSEKEKIKSGQIDVVIGTHALI-----QEDVHFKNLGLVIIDEQHR-----FGVKQREALMNKGKMVDTLVMSATPIPRSMALA.............. 249
26 -11.500d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  55......................ETTPDQAQAINAVLSDMDRLVCGDVGFGKTEVAMRAAFLAVDNHK------QVAVLVPTTLLAQQFRDRFANWPVRIEMISRFRSAKEQTQLAEVAEGIDILIGT-----HKLLQSDVKFKDLGLLIVDEEHR-----FGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIAT.. 233
27 -11.100d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  18  82.............KYVDILKIRRELPVRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFD---EMPHLENTQVACTQPRRVAAMSVAQRVAE------------GEEVGYSIRKTSNKTILKYMTDGMLLREAMEDH-DLSRYSCIILDEAERTLATDILMGLLKQVVKRRPDLKIIIMSATL--DAEKFQRYFNDAPL...... 264
28 -11.100d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  18  13............LRPYQIKGFSWMRFMNKLGFGICLAD-------DMGLGKT----LQTIAVFSDAKKENELTPSLVICPL-SVLKNWEEELSKFAPHLRFAVFHE-----DRSKIKLEDYDIILTTYAVLL---RDTRLKEVEWKYIVIDEAQNIKNPQ--TKIFKAVKELKSKYRIALTGTPIENKVDDL............... 170
29 -10.500d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  153...........................QKVAAAVALTRRISVISGGPGTGKTT--TVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLT------------DEQKKRIPEDASTLHRLLGALRHHAGNPLHLDVLVVDEAS-MIDLPM---MSRLIDALPDHARVIFLG......................... 295
30 -10.300d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}  ali model 3D-neighbors follow..  20  10...................AYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSL--LERFYQPTADGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDVENMPDQLNTEVGERGVKISGGQRQRLAIARAKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLST.................... 200
31 -9.600d4q7ka_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}  ali model 3D-neighbors follow..  19  4..................................VKPGSLVAVLGETGSGKTLMNLIPRLIDPERGR-DELDVRTVKLKDLRGHISAVPQETVLFSGTIKENLKWGREDATDDIISLPEGYDSRVERGGRNFSGGQKQRLSIARAKVLILDDCTSSVDPITEKRILDGLKRYTKGCTTFIITQKIPT.................... 178
32 -9.570d2gk6a1 c.37.1.19 (A:295-324,A:416-702) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  91...........................QVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNG-----PVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLAMNADVICCT-------AGDPRLAKMQFRSILIDESTQAT------EPECMVPVVLGAKQLILVGCQLGPVVMC................ 288
33 -9.430d2ff7a2 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  26..................................IKQGEVIGIVGRSGSGKSTL--TKLIQRFYIPENDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEISELREGYNTIVGEQGAGLSGGQRQRIAIARAKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLST.................... 200

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.