current user: public

If you have questions about the server, please let us know.

Query: d3p91a1 d.131.1.0 (A:1-127) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MCAFHAKFKEAALFKRVVESLKSTIDKTNFDCSDAGIAVQCMDNSHVSLVSLLIETDAFDEFQCLKPITLGINLTHLSKILKALDNDCGLILDVKKVDDAVLSITSEGTNKTMKFGLNLVDIEAESVLast
1 -64.600d3p91a1 d.131.1.0 (A:1-127) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}  ali model 3D-neighbors  100  1MCAFHAKFKEAALFKRVVESLKSTIDKTNFDCSDAGIAVQCMDNSHVSLVSLLIETDAFDEFQCLKPITLGINLTHLSKILKALDNDCGLILDVKKVDDAVLSITSEGTNKTMKFGLNLVDIEAESV 127
2 -57.400d1u7ba1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  32  1..MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLLVFEAPNQEKVSDYEMKLMDLDVEQL 126
3 -57.100d1plqa1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  39  1..MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSILLFEDTKKDRIAEYSLKLMDIDADFL 126
4 -53.200d1iz5a1 d.131.1.2 (A:2-120) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  30  2...FEIVFEGAKEFAQLIDTASKLIDEAAFKVTEDGISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNLDHLKKILKRGKAKDTLILKKGEENFLEITI---QGTATRTFRVPLIDVEE... 119
5 -53.200d1ud9a1 d.131.1.2 (A:1-119) Proliferating cell nuclear antigen (PCNA) {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  22  2....HIVYDDVRDLKAIIQALLKLVDEALFDIKPEGIQLVAIDKAHISLIKIELPKEMFKEYDVPEEFKFGFNTQYMSKLLKAAKRKEEIIIDADSPEVVKLTL---SGALNRVFNVNNIEVLPP.. 119
6 -51.500d3aixa1 d.131.1.0 (A:1-126) automated matches {Sulfolobus tokodaii [TaxId: 273063]}  ali model 3D-neighbors follow..  19  1...MRVKVIDADAFSYIFRTLEEFIDEITLDFTSDGLKIRGIDPSRVTFIDILIPAGYFEEYNVEKEEKVGVKLEDFTDVLKTVTKNDSLYLETDENQNIKVTL---DGVYERTFTFPSIVASEIET 121
7 -46.900d1rwza1 d.131.1.2 (A:1-122) Proliferating cell nuclear antigen (PCNA) {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  1...MIDVIMTGELLKTVTRAIVALVSEARIHFLEKGLHSRAVDPANVAMVIVDIPKDSFEVYNIDEEKTIGVDMDRIFDISKSISTKDLVELIVEDESTLKVKFG------SVEYKVALIDPSAIR. 117
8 -42.500d3ifva1 d.131.1.2 (A:2-112) Proliferating cell nuclear antigen (PCNA) {Haloferax volcanii [TaxId: 2246]}  ali model 3D-neighbors follow..  16  6.........SAATLRDALDSVSVLVDECKIRLNEESLSIRAVDPANVGMVDLTLDAAAFESYEAHGG-VIGVNLSRLEEVAGMAGAGDLIHLTLDEETRKLNIRIDG-----LSYTLALID...... 111
9 -19.200d1iz5a2 d.131.1.2 (A:126-246) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  12.........LGEVLKAAVKAASLVSDSIKFIARENEFIMKAEGETQEVEIKLTLEDEGLLDIEVQEETKSAYGVSYLSDMVKGLGKADEVTIKFGNEMPMQMEYYIRDEGRLTFLLAP......... 120
10 -17.800d1ud9a2 d.131.1.2 (A:127-245) Proliferating cell nuclear antigen (PCNA) {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  11  9.........NASGLKNAIGEIAEVADTLLISGNEEKVVVKGEGENKVEVEFSK-DTGSLADIEFNKESSSAYDVEYLNDIISLTKLSDYVKVAFADQKPMQLEFNMEGGGKVTYLLAPKLS...... 119
11 -17.700d2ix2b2 d.131.1.0 (B:127-245) automated matches {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  9.........LTITFADIIDELSDLGEVLNIHSKENKLYFEVIGDLSTAKVELS-TDNGTLLEASGADVSSSYGMEYVANTTKMRRASDSMELYFGSQIPLKLRFKLPQEGYGDFYIAPRAD...... 119
12 -17.400d3ifva2 d.131.1.2 (A:113-243) Proliferating cell nuclear antigen (PCNA) {Haloferax volcanii [TaxId: 2246]}  ali model 3D-neighbors follow..  12  22.........EGTHLDRGIKAADMVSDHIRLRVDGAEETFHIEAEGDTDDVDLSLPPAD-LISIEAGAADSLFSLDYLKDMNKAIPTDAEVTVELGEEFPVKLHYQIAEGMGTITYMLA......... 129
13 -16.200d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  14.........PSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI....... 129
14 -15.400d1rwza2 d.131.1.2 (A:123-244) Proliferating cell nuclear antigen (PCNA) {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  11  12.........DAGEFKKAIAAADKISDQVIFRSDKEGFRIEAKGDVDSIVFHMTETE---LIEFNGGEARSMFSVDYLKEFCKVAGSGDLLTIHLGTNYPVRLVFELVGGRAKVEYILA......... 117
15 -14.600d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  14.........PSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKS-GFLQFFLAPKFNDEE... 132
16 -10.800d3p91a2 d.131.1.0 (A:128-254) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}  ali model 3D-neighbors follow..  14  14.........SSAEFLKITKDFSALGDDITIGCTKNEVTLTTMCETCMTLSALENVDSNGLQIEHNKDVTASFALKQISEFAKSAPLADNVKLSLSGQAPLIMEFKGEA................... 116

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.