current user: public

If you have questions about the server, please let us know.

Query: d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVLast
1 -110.000d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors  100  1AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIV 196
2 -92.000d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  1.ADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCG--LDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYM 197
3 -91.000d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  1.SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG--MDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFM 199
4 -89.200d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  1GNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSG--RDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDITVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLS-QDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHL 198
5 -87.200d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  37  9VYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEG--HDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDI-KVHACIGGTSFVEDADAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLS-SGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFM 204
6 -85.300d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  33  1.TQFTRFPFQPFIIEAIKTLRFYKPTEIQERIIPGALRG--ESMVGQSQTGTGKTHAYLLPIMEKIKPERAEVQAVITAPTRELATQIYHETLKITKFCRMIVARCLIGGTDKQKALQPHIVIGTPGRINDFIREQALDVHTAHILVVDEADLMLD-MGFITDVDQIAARMPKDLQMLVFSATIPEKLKPFLKKYM 200
7 -81.500d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  13TKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQG--RDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGV-QSAVIVGGIDSMSQSKPHIIIATPGRLIDHLENKGFNLRALKYLVMDEADRILN-MDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAAL 210
8 -81.300d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  32  2..EFKDFPLKPEILEALHGRGLTTPTPIEAAALPLALEG--KDLIGQARTGTGKTLAFALPIAERLAPSQRKPRALVLTPTRELALQVASELTAVAPHLK---VVAVYGGTGYGKQKGADAVVATPGRALDYLRQGVLDLSRVEVAVLDEADEMLS-MGFEEEVEALLSATPPSRQTLLFSATLPSWAKRLAERYM 197
9 -81.000d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  27  1........MNEKIEQAIREMGFKNFTEVQSKTIPLMLQG--KNVVVRAKTGSGKTAAYAIPILEL------GMKSLVVTPTRELTRQVASHIRDIGRYMDT-KVAEVYGGMPYKAQINADIVVATPGRLLDLWSKGVIDLSSFEIVIIDEADLMFE-MGFIDDIKIILAQTSNRKITGLFSATIPEEIRKVVKDFI 182
10 -72.500d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  22ITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQG--KDVLGAAKTGSGKTLAFLVPVLEAL-TSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGKHEAERINNINILVCTPGRLLQHMDETSFHATDLQMLVLDEADRILD-MGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLARLSL 222
11 -69.700d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  12IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEK--RDLMACAQTGSGKTAAFLLPILSQIGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRP-CVVYGGADIGQQIGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLD-MGFEPQIRRIVEQDTGVRHTMMFSATFPKEIQMLARDFL 230
12 -68.800d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  22IATFQQLKINSRLLQNILDAGFQMPTPIQMQAIPVMLHG--RELLASAPTGSGKTLAFSIPILMQLQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKSKKFDILVTTPNRLIYLLKQDPIDLASVEWLVVDESDKLFEKTGFRDQLASIFLACSHKVRRAMFSATFAYDVEQWCKLNL 230
13 -68.600d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  12IKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSG--RDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRPYGLIICPSRELARQTHGILEYYCRLLQELRCALCIGGMSVKEQMGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMID-MGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSAL 222
14 -66.200d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  17TCRFKDFQQYPDLLKSIIRVGILKPTPIQSQAWPIILQG--IDLIVVAQTGTGKTLSYLMPGFIHLDSQPISPGMLVLTPTRELALHVEAECSKYSY--KGLKSICIYGGRNRNGQIGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLD-MEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYL 219
15 -52.600d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  15  16LCLFPEDFLLKEFVE-FFRKCVGEPRAIQKMWAKRILRK--ESFAATAPTGVGKTSFGLAMSLFLA---LKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENLIHGRIPKREKENFKIVITTTQFLSKHYRE----LGHFDFIFVDDVDAILKALGFHYDLKTKSWVGEARGCLMVSTATAKKGKKAELFRQL 221
16 -28.000d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  14  9.......SISSYAVGILKEEGIEELFPPQAEAVEKVFSG--KNLLLAMPTAAGKTLLAEMAMVREA---IKGGKSLYVVPLRALAGEKYESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLL-KRGATLEILVTKMRRMNKALRVIGLSATAPN.......... 184
17 -23.700d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  15  4.....................RRDLIQPRIYQEVIYAKCKETNCLIVLPTGLGKTLIAMMIAEYRLTKYGG--KVLMLAPTKPLVLQHAESFRRLFN-LPPEKIVALTGEKSPEERSRAKVIVATPQTIENDLLAGRISLEDVSLIVFDEAHRAVGNYAYV-FIAREYKRQAKNPLVIGLTASPGSTPEKIME... 175
18 -20.000d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  18  113.......................EPHWYQKDAVFEGLVN--RRRILNLPTSAGRSLIQALLARYYL--ENYEGKILIIVPTTALTTQMADDFVDYRLFSHAMIKKIGGGASKDDKKNDAPVVVGTWQTVVKQPKE----FSQFGMMMNDECHLA------GKSISSIISGLNNCMFKFGLSGSLRDG......... 265
19 -19.200d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  15  1....................................MLKKGMTTVLDFHPGAGKTRRFLPQILAEC---RRRLRTLVLAPTRVVLSEMKEAFHGLDVKFHTQAF-------SAHGSGREVIDAMCHATLTYRMLEPT-RVVNWEVIIMDEAHFL-DPASIAARGWAAHRARANESATILMTATPP........... 138
20 -16.600d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  5....EVLNLESGAKQVLQETGYQQFRPGQEEIIDTVLSG--RDCLVVMPTGGGKSLCYQIPALLL---------TVVVSPLISLMKDQVDQLQANG-----VAAACLNSTQTREQQLEVRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEA-HCISQWGFRPEYAALLRQRFPTLPFMALTATADDTTRQ...... 190
21 -16.500d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  14  1.................................PPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQ--------KVLVLNPSVAATLGFGA---YMSKAHGVDPNIRTGVRTITT---GSPITYSTYGKF---LADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATAT............. 135
22 -15.000d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  13  1...............................CFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVRE----KKRLRTVILAPTRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEI-------VDLMCHATFTSRLLQPI-RVPNYNLNIMDEAHSSIAARGYISTRVE-----MGEAAAIFMTATPPGTRDAFPDS.. 152
23 -14.800d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  19  85.........................TNAQKRAHQEIRNDKPMNRLLQGDVGSGKTVVAQLAILDNYEAGF---QTAFMVPTSILAIQHYRRTVESFSKFNIHVALLIGATTPSEKEKQIDVVIGTHALI-----QEDVHFKNLGLVIIDEQHR------FGVKQREALMNKGKMVDTLVMSATPIPRSMALA.... 249
24 -14.600d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  18  70.......................SLRDYQEKALERWLVDKRGCIV--LPTGSGKT------HVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGE-----------GEFSGRIKELKPLTVST---YDSAYVNAEKLGNRFMLLIFDEVHHL------AESYVQIAQMSIAPFRLGL-TAT............. 204
25 -13.100d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  18  13.............LRPYQIKGFSWMRFMNKLGFGICLAD---------DMGLGKTLQ-TIAVFSDAKKENELTPSLVICPLSVLKNWEEE----LSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLL---RDTRLKEVEWKYIVIDEAQNIKNPQ---TKIFKAVKELKSKYRIALTGTPIENKVDDL..... 170
26 -11.800d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  55.......................ETTPDQAQAINAVLSDLAMDRLVCGDVGFGKTE---VAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDISRFRSAKEQTQILAEVAEGK---IDILIGT-----HKLLQSDVKFKDLGLLIVDEEHR------FGVRHKERIKAMRANVDILTLTATPIPRTLNMA.... 221
27 -11.200d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  19  89............................IRRELPVHLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQ---RVAEEMDVKLGEEVGYSIRFENKTSNKTIL-TDGMLLREAMEDH-DLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAE......... 253
28 -9.830d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  18  21.QRLDDIVGQEHIVKRLKHY-------VKTGSMP--------HLLFAGPPGVGKTTA-ALALARELFGENWRHNFLELNASDERGINVIRE------------------------------------KVKEFARTKPIGGASFKIIFLDEADAL--TQDAQQALRRTMEMFSSNVRFILSCNYSSKIIEPIQSR.. 159

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.