current user: public

If you have questions about the server, please let us know.

Query: d3tdca1 c.14.1.0 (A:1719-2042) automated matches {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst TPYVTKDLLQAKRFQAQTLGTTYIYDFPEMFRQALFKLWGSPDKYPKDILTYTELVLDSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIGSFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFKYLYLTPQDYTRISSLNSVHCKHIEEGGESRYMITDIIGKDDGLGVENLRGSGMIAGESSLAYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQLGGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDNLast
1 -114.000d3tdca1 c.14.1.0 (A:1719-2042) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1TPYVTKDLLQAKRFQAQTLGTTYIYDFPEMFRQALFKLWGSPDKYPKDILTYTELVLDSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIGSFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFKYLYLTPQDYTRISSLNSVHCKHIEEGGESRYMITDIIGKDDGLGVENLRGSGMIAGESSLAYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQLGGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDN 324
2 -55.500d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  20  5TMEGRVEQLAEQRQVIEAGGGERRVE-------------KQHSQGKQTARERLNNLLDP-HSFDEVGAFRKHRTTAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQ------------------------------------------------------------------EGIDSLSGYGKMFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQVIKSVTGEDV--TADELGGAEAHMISGNIHFVAEDDDAAELIAKKLLSFLPQNN 253
3 -46.400d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  15  31...AVESDIHESIKKALDAG--------------ITSEEKLNERGQLSAMQRINALIDP-GTWCPLNSLFNPENNKFGT-TNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGG--------------------------------------------------------------TPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGILSGMNPKGYIDKVPAPGSVPIHYDTGFFREVYQNDLGVIDGIKKYISYLPA.. 289
4 -41.000d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  5.....CDSCGQVLYRAELERNLEVCP-------------KCDHHMRMTARNRLHSLLDE-GSLVELGSELEPKQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARM------------------------------------------------------------------QEALMSLMQMAKTSAALAKQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEKALIGFAGPRVIEQTVREKL---PPGFQRSEFLIEKGAIDMIVRRPELKLASILAKLMNLPAPN 262
5 -22.500d2f9ia1 c.14.1.0 (A:1-314) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  15  52................................KPWDRVQIARLQERPTTLDYIPYIFDS-FMELHGDRNFRDDP-------AMIGGIGFLNGRAVTVIGQQIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATN------------------------------------------------------------------IEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLGIIDDIEQQALAIKSAFV...... 284
6 -16.300d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  14  27..........................................GKKGYDVRDVIAKIVDW-GDYLEVKAGYATN---------LVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKM------------------------------------------------------------------YAYSEATVPKITVVLRKAYGGSYLAMC-ADAVYAWPSAEIAVMGAEAANVIFRKEIKAADDPDAMRAEKIEEYQNAFNTPYVAAARGQVDDVID--PADT 236
7 -12.400d3gf3a2 c.14.1.4 (A:292-587) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  12  29..........................................QKRPYDIYEVIARLFDN-SEFSEYKKGYGPE---------MVTGLAKVNGLLVGVIANVQGGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAE---------------------------------------LLGLGQSLI--------------------------YSIENSKLPSLEITIRKASAAAHYVLGACEYYVMPGETAANAMYSRKLVKAK-NDMIQMYTDKSRPKYCTEKGMVDEIV-DMTEVRPYIQAFTEAAYQNP 274
8 -9.580d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  20  94........................................................................................................................................................................................................................................PVIALLKGYSMGGGLELAESADIRIAMSDAVIGQGGNVILPKLVGRGSAAYLAMSGNAQEAMALGLVDEVVDDEAKAWKIIDDICKKPK... 196
9 -9.490d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  17  98........................................................................................................................................................................................................................................PLIIAVKGVAIGIGVTILLQADLVFADNTALFQIGASQLLVKQAGYHKAAELLFTANAETALQAGLVNEIVEDAYATAQATAQHLTALPL.. 201
10 -9.300d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  16  97.......................................................................................................................................................................................................................................LVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLKDTLENTIGHRAAERALQLGPPAEALQVGIVDQVVPEEQTALSAIAQWMAIPD... 205
11 -9.280d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  16  108........................................................................................................................................................................................................................................PVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLGGLQRLPHLIGRGRTAHLALTGDAATAERWGLVTEVLPDQDALFARAEALAEHLAALP 213
12 -9.260d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  12  102.......................................................................................................................................................................................................................................VPIIAALRGAVVGGGLELASAAHLRVMDQSTYFALGATIRVSDMIGKYRMIDMILTGQGQEAADLGLAQYITEGSDKAMELADKIASNLP... 207
13 -9.210d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  14  109........................................................................................................................................................................................................................................PVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVGTLQRLPKVIGNRSLVNELTFTARKMMADEGLVSRVFPDKDVMLNAAFALAADISSKS 215
14 -9.060d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  15  96........................................................................................................................................................................................................................................PTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMVGAAILGFTHGFSTMQEIIYQCDAPRCVDYRLVNQVVESSAAAITQAHVMASYPA... 200
15 -9.060d4qiia_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  12  33..............................................................................................TVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWA---------------------FCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMP----------------VVICLVNGWAAGGGHSLHVVCDLTLASREYARF-YGSAYLARQVGQKFAREIFFLGTAEQMHQMGAVNAVAEHAEVGLQWAAEINAKSP... 241

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.