current user: public

If you have questions about the server, please let us know.

Query: d3ui4a1 d.26.1.1 (A:36-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRKLast
1 -80.500d3ui4a1 d.26.1.1 (A:36-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK 96
2 -67.400d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  34  2KTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTG------PLHTQFGYHIIKVLYRN 92
3 -59.400d2kgja1 d.26.1.0 (A:1-94) automated matches {Escherichia coli [TaxId: 83333]}  ali model 3D-neighbors follow..  19  4QRTRYSIIQTKTEDEAKAVLDELNKGGDFAALAKEKSADIARNGGDMGWLEDATIPDELKNAGL-KEKGQLSG------VIKSSVGFLIVRLDDIQ 94
4 -54.500d2mnta_ d.26.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}  ali model 3D-neighbors follow..  24  32TRSRADAINLAQAILAQHKERKTWSLDEFVQVVRDFSECGSKRDGDLGMVESGTYTEGFDTVAFSLKSGEVSA------PVETELGVHLIYRVE.. 120
5 -54.400d2pv1a_ d.26.1.1 (A:) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  21  1TELNLSHILIEAESQARAIVDQARNGADFGKLAIAHSADQQANGGQMGWGRIQELPGIFAQALSTAKKGDIVG------PIRSGVGFHILKVNDLR 103
6 -53.800d2jzva1 d.26.1.0 (A:140-245) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  30  1DSKKASHILIEAKQKAEEIQKEVKDPSKFGEIAKKESMDTGSKDGELGYVLKGQTDKDFEKALFKLKDGEVSE------VVKSSFGYHIIKADK.. 106
7 -51.800d2itka2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  36  3ARVRCSHLLVEALELINGYIQKIKSGEDFESLASQFSDCSSKARGDLGAFSRGQMQKPFEDASFALRTGEMSG------PVFTDSGIHIILRTE.. 113
8 -50.800d4g2pa1 d.26.1.0 (A:280-386) automated matches {Salmonella enterica [TaxId: 588858]}  ali model 3D-neighbors follow..  33  4TEVHARHILLQARLKLEEIAADIKSGTTFAAAAKEYSQDPGSQGGDLGWATPDIFDPAFRDALTKLHKGQISA------PVHSSFGWHLIELLDTR 105
9 -6.950d1e19a_ c.73.1.1 (A:) Carbamate kinase {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  12  223EEVNADIFMILTDVNG------LYYGTEKEQWLREVKVEELRKYYEEGHFKAGSMGPKVLAAIRFIEWG-IAHLEKAVEALEGKTGTQVL...... 312
10 -6.620d3a4ra1 d.15.1.0 (A:339-412) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  5.......LRVQGKEKHQMLEISLSPDSPLKVLMSHYEEAMGLSGHKLSFFFDGTKLSGKELPALGLESGDLIE....................... 71

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.