current user: public

If you have questions about the server, please let us know.

Query: d3wu2h_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
# Score Template Links and tools%idFirst ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALast
1 -64.500d3wu2h_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}  ali model 3D-neighbors  100  1ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA 63
2 -6.180d1wxua1 b.34.2.0 (A:8-87) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  27  32......GDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILG................. 71
3 -6.170d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]}  ali model 3D-neighbors follow..  29  4.........LDKRAKSFILVAGGIGITPMLSMARQL........................... 30
4 -6.030d1ug3a2 a.118.1.14 (A:1438-1564) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  75........LQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSW.. 127
5 -5.940d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]}  ali model 3D-neighbors follow..  25  1.........LRDVKRPVLMLAGGTGIAPFLSMLQVL........................... 27
6 -5.860d4eh1a2 c.25.1.0 (A:111-238) automated matches {Vibrio cholerae [TaxId: 243277]}  ali model 3D-neighbors follow..  21  11...................ISAGVGATPMQAILHTLAKQNKSGVTYLYACN............ 42
7 -5.460d3ozua3 c.25.1.0 (A:262-403) automated matches {Ralstonia eutropha [TaxId: 381666]}  ali model 3D-neighbors follow..  12  11...................ISGGVGLTPMVSMLKVALQAPPRQVVFVHGAR............ 42
8 -5.410d2dgta1 d.58.7.0 (A:75-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  3STKLHVGNILRAKFEEYGPVIKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQ........ 70
9 -5.340d1wf2a1 d.58.7.1 (A:8-92) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  8NSRVFIGNLVEAIFSKYGKIVKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDIN........ 76
10 -5.260d3juia1 a.118.1.0 (A:548-715) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  85........FRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAGETILSWFS 139

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.