current user: public

If you have questions about the server, please let us know.

Query: d3zxfa_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIFLast
1 -79.100d3zxfa_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF 135
2 -70.500d5gzca_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  33  10.VIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSPRADVAFHFNPRFKRACIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGF. 145
3 -70.100d5gm0a1 b.29.1.0 (A:2-144) automated matches {Toxascaris leonina [TaxId: 59264]}  ali model 3D-neighbors follow..  33  7.PVPYRSKLTEPFEPGQTLIIKGKTAEDSVRFTINLHNTSASGNDVPLHISVRFDEGKIVFNTFSKGEWGKEERKS-NPYKKGDDIDIRIRAHDSKFSISVDQKEVKEYEHRVPLSSVTHFSVDGDILITYIHW. 140
4 -69.400d1g86a_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  1SLLPVPYTEAASLSTGSTVTIKGRPLVNEPYLQVDFHTEMKEESDIVFHFQVCFGRR-VVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNV. 136
5 -68.600d5gm0a2 b.29.1.0 (A:145-278) automated matches {Toxascaris leonina [TaxId: 59264]}  ali model 3D-neighbors follow..  33  2YPVPYESGLAGGLAPGKSLLIFATPEKKGKRFHINLLKK---NGDIALHFNPRFDEKAIVRNSLISGEWGNEEREGKNPLEKGIGCDLEFRNEEYAFQIYVDGERFATYAHRLDPHDINGLQIGGDVEVTGIQMV 134
6 -68.100d5it6a_ b.29.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  30  1...PFCGHIKGGMRPGKKILVMGIVDLNPESFGISLTCGESPPADVAIELKAVFTDRQFIRNSCVAGEWGEEQSSPYFPFIPDQPFRVEILCEHPRFRIFVDGHQLFDFYHRITLSAIDTIKINGDLQLTKLG.. 134
7 -67.700d3naja2 b.29.1.0 (A:155-291) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  36  4.RLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKS--KDIALHLNPRLNIKAFVRNSFLQESWGEEERNTSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFELSSIDTLEINGDIHLLEVRSW 137
8 -67.300d3zsja_ b.29.1.3 (A:) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  36  3.IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRG----NDVAFHFNPRFNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKLNEISKLGISGDIDLTSASY. 135
9 -66.800d2ymza1 b.29.1.0 (A:4-131) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  25  3......EMFNLDWKSGGTMKIKGHISEDAESFAINLGCKSS---DLALHFNPRFNESVIVCNSLCSDNWQQEQRDKHFNFYKGSTVKIIVEFLGDKFLVKLPDGHEVEFPNRHGYDKISYLNILGGFKVTSFKV. 127
10 -66.700d2zhna_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  32  12.AVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISF. 145
11 -65.000d4q27a_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  32  2...CGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSN---NLCLHFNPRFNANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAF. 133
12 -63.000d1is3a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster) [TaxId: 7943]}  ali model 3D-neighbors follow..  24  1.DRAEVRNI--PFKLGMYLTVGGVVNSNATRFSINVGESTD---SIAMHMDHRFSYVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRL. 133
13 -62.500d3vv1a_ b.29.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  32  13.QTPVNIPVQ-GFSNGARLRLVLLPTSADSRFHINLRTP----DDIVLHFNARFDEGAVVNNSTSGGGWQSEDRHA-NPFQQNKIYTLEFVSNGGIISIFVNGAHFADFVERTPSHGVHLIEIEGGVHVHSAHV. 139
14 -55.400d2wkka_ b.29.1.3 (A:) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}  ali model 3D-neighbors follow..  22  6.FVNNQVKLQNDFKPESVAAIRSSAFNSKGGTTVFNFL--SAGENILLHISIRPGENVIVFNSRKNGAWGPEERIPYAEKFRPPNPSITVIDHGDRFQIRFDYGTSIYYNKRIK-ENAAAIAYNAENSLFSSPV. 136
15 -53.600d3wg3a1 b.29.1.0 (A:0-160) automated matches {Agrocybe cylindracea [TaxId: 64608]}  ali model 3D-neighbors follow..  16  13.SAGASVDLAAPVTTGDIVTFFSSALNSPNNTALNLLSE---NGAYLLHIAFRLQENVIVFNSRPNAPWLVEQRVSNQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQITTSSLSYNSTEGTSIFSTVVEA 155
16 -51.300d2r0ha_ b.29.1.0 (A:) automated matches {Coprinus cinereus}  ali model 3D-neighbors follow..  21  6.RLESTVDLSEPLKDNGIIVFQSDGPTGIDNTNVNLINA---KGDVLLHIGIRRRENAFVFNSIYGESRGPEERIPEGTFGDRRDPSITIFDHPDRYQIMIDYKTVYYYKKRLECEKVSYKINEGQTPPFSDVL. 149
17 -11.600d1y4wa1 b.29.1.19 (A:373-536) Exo-inulinase {Aspergillus awamori [TaxId: 105351]}  ali model 3D-neighbors follow..  36..................VDLSFSAKSKASTFAIALRASANFTEQTLVGYDFAKQQIFLDRTHSGDVSFDETVYHGPLTPDSTGVVKLSIFVDRSSVEVFGGQGETTLTAQIFPSSDAVHARLGGTTEDVRADIY 158

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.