current user: public
If you have questions about the server, please let us know.

Query: d4aeaa_ g.7.1.1 (A:) alpha-Cobratoxin {Monocled cobra (Naja kaouthia) [TaxId: 8649]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTLast
1 -41.100d4aeaa_ g.7.1.1 (A:) alpha-Cobratoxin {Monocled cobra (Naja kaouthia) [TaxId: 8649]}  ali model 3D-neighbors  100  1IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPT 67
2 -30.100d1ug4a_ g.7.1.1 (A:) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}  ali model 3D-neighbors follow..  28  1LKCNQLIPPFYKTCAAGKNLCYKMF---MVAAPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN.... 60
3 -29.000d2h8ua_ g.7.1.1 (A:) Bucain {Malayan krait (Bungarus candidus) [TaxId: 92438]}  ali model 3D-neighbors follow..  37  4LIKYSQANESSKTCPSGQLLCLKKW--EIGNPSGKEVKRGCVATCPKPWKNEIIQCCAKDKCNA... 65
4 -24.700d1v6pa_ g.7.1.1 (A:) Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) [TaxId: 8656]}  ali model 3D-neighbors follow..  35  4HNQQSSQTPTTTGCSGGETNCYKKR---WRDHRGYRTERGCG--CPSVKNGIEINCCTTDRCNN... 62
5 -23.700d2h7za1 g.7.1.1 (A:1-75) Irditoxin subunit A {Brown tree snake (Boiga irregularis) [TaxId: 92519]}  ali model 3D-neighbors follow..  26  15.RMTSSDCSTALRCYRGS--CYTLYRPDENCEL-KWAVKGCAETCPTAGPNERVKCCRSPRCND... 74
6 -23.700d2mj0a1 g.7.1.0 (A:101-165) automated matches {Monocled cobra (Naja kaouthia) [TaxId: 8649]}  ali model 3D-neighbors follow..  34  5.NCPEMFCGKFQICRNGEKICFKKLHQR--RALSWRYIRGCADTCPVGKPYEMIECCSTDKCNR... 65
7 -22.300d1ff4a_ g.7.1.1 (A:) Muscarinic toxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]}  ali model 3D-neighbors follow..  36  5.TTKSIGGVTTEDCPAGQNVCFKRWHYV--TPKNYDIIKGCAATCPKVDNNDPIRCCGTDKCND... 65
8 -22.200d1jgka_ g.7.1.1 (A:) Candoxin {Malayan krait (Bungarus candidus) [TaxId: 92438]}  ali model 3D-neighbors follow..  36  10....TCRAGELKVCASGEKYCFKES---WREARGTRIERGCAATCPKGSVGLYVLCCTTDDCN.... 66
9 -12.300d1fsca_ g.7.1.1 (A:) Fasciculin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]}  ali model 3D-neighbors follow..  24  7...TTTSRAILTNC--GENSCYRK---SRRHPPKMVLGRGCG--CPPGDDNLEVKCCSPDKCN.... 60
10 -11.800d1f94a_ g.7.1.1 (A:) Bucandin {Malayan krait (Bungarus candidus) [TaxId: 92438]}  ali model 3D-neighbors follow..  29  5.RCGVSGCHLKITCSAEETFCYKWLNKISNE-------LGCAKTCTEIDTNVYNKCCTTNLCN.... 62
11 -11.700d2fd6u1 g.7.1.3 (U:1-80) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  5.QCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELEVEKSCTHSEKTNRTSLTEVVCGLDLCNQ... 78
12 -10.900d1drsa_ g.7.1.2 (A:) Dendroaspin {Dendroaspis jamesoni kaimosae [TaxId: 8619]}  ali model 3D-neighbors follow..  25  8....GTKPPTTETC--QEDSCYKNIWT-----FDNIIRRGCG--CFTPRGDMPPYCCESDKCN.... 58
13 -9.380d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  23.........FLIDCRGPMNQCLVA-TGTHEPKNQSYMVRGCASMCQHAHNHIDVSCCTKSGCNH... 85
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.