current user: public

If you have questions about the server, please let us know.

Query: d4e6sa_ a.28.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst GRPRPEVAHQLFRCFQYQEDMGPRASLGRLRELCNHWLRPALHTKKQILELLVLEQFLSVLPPHVLSRLHGAPLRDGEEVAQLEGLast
1 -72.400d4e6sa_ a.28.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors  100  1GRPRPEVAHQLFRCFQYQEDMGPRASLGRLRELCNHWLRPALHTKKQILELLVLEQFLSVLPPHVLSRLHGAPLRDGEEVAQLEG 85
2 -66.700d4bhxa1 a.28.3.0 (A:3-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  39  2...DSEFFHQRFRNLIYVEFVGPRKTLIKLRNLCLDWLQPETRTKEEIIELLVLEQYLTIIPEKLKPWVRAKKPENCEKLVTLLE 83
3 -6.800d2vzua5 b.1.4.0 (A:778-899) automated matches {Amycolatopsis orientalis [TaxId: 31958]}  ali model 3D-neighbors follow..  14  61.....................................SKVVDSAGKPVLPVEWNANAVSLWPGELTAKYRTADLKGSKPSVRISG 111
4 -5.510d1xzpa3 d.250.1.2 (A:1-117) TrmE formyl-THF-binding domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  16  43............RKAIHGWIHENGEDVDEV--VVVFYKSPKSYTGEDMVEVLVVKKLLDLF---LKSGARMAEPGEFTKRAFLNG 116
5 -5.510d1e2wa1 b.2.6.1 (A:1-168,A:233-251) Cytochrome f, large domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}  ali model 3D-neighbors follow..  20  1...........YPVFAQQNYANPREANGRI---CHLAQKAEIEVPQAVLPDTVFEAVIEL-PYDKQ................... 56
6 -5.450d1ifqa1 d.110.4.1 (A:2-127) Sec22b {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  75.................EAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYI................ 126
7 -5.330d1prtb2 d.169.1.2 (B:4-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis [TaxId: 520]}  ali model 3D-neighbors follow..  23  24...........TRALTVAELRGSGDLQEYLRHVTRGW................................................ 49
8 -5.310d1xmca1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  18  2............RTFQYQDS--PSLPVPALEESLKKYLKPFANEDEYKKTEEIVQKFQEGAGKRLHQKLLERARGK......... 67
9 -5.150d2nrac2 a.4.5.10 (C:152-268) Replication initiation protein PI {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  1........KNKFTTQLLTASLRLSSQYSSLYQLIRKHYSNFKKKNYFIISVDELKEELIA......................... 53
10 -5.110d1px5a1 a.160.1.2 (A:201-346) 2`-5`-oligoadenylate synthetase 1, OAS1, second domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  28  1......................PTK-LKSLIRLVKHWYQGNKLPPQYALELLTVYAW............................ 40

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.