current user: public

If you have questions about the server, please let us know.

Query: d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst GAIKSTSEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENNPEIRSVVITGEGAVFCAGGNLQRLQANRREAPEVQAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMSYSTVGLSPDGGGSWSLARSLPRALASELLMGGERISAQRLHDLGLVNKVASAGDALSEALRMAGQLNARAPNALASIKELINEASSNTLSQQLACERDHFVRNLHHSNGGEGIAAFLGKRTPQYRLast
1 -107.000d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors  100  1GAIKSTSEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENNPEIRSVVITGEGAVFCAGGNLQRLQANRREAPEVQAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMSYSTVGLSPDGGGSWSLARSLPRALASELLMGGERISAQRLHDLGLVNKVASAGDALSEALRMAGQLNARAPNALASIKELINEASSNTLSQQLACERDHFVRNLHHSNGGEGIAAFLGKRTPQYR 257
2 -103.000d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}  ali model 3D-neighbors follow..  29  3.TLDFEVVNNVGWIRMNRAAKHNPFDAELRADLMTVLERVRDDADIRVLVLTSHPGSFCAGGNLHVLRDNLDSGPAYWQQRIKTGLRFIHDMLNLGRPVIAAVDGPAFGAGFALSLTADIVLASPRARFSMAYLRLGLVPDLGALYLLPRAVGLQRAKELMFSTRELDAEEAHRLGLVMEVHESEALEQRAREIAESLVQAAPTALALTKAALNVSLDSDEQTMFSLEAASQAAAFSTKEPRAAIEALLSKQPPPFR 258
3 -102.000d3gowa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  33  2..VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDRKPD----YEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQ 252
4 -101.000d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}  ali model 3D-neighbors follow..  26  4.AIGHRVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIPLDKGVAGDHFRIAALWWHQMIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCAWHTIGIGNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKERFHAGWMQPVEECTEFEIQNVIASVTHPHFMPCLTRFLDGHRADRP 261
5 -100.000d4f47a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  30  3.DALVEQRGHTLIVTMNRPSRRNALSGEMMQIMVEAWDRVDNDPDIRCCILTGAGGYFCAGMDLKAATKKPPGDSFKDGSYDPSRIDALLKGRRLKKPLIAAVEGPAIAGGTEILQGTDIRVAAESAKFGISEAKWSLYPMGGSAVRLVRQIPYTVACDLLLTGRHITAAEAKEMGLVGHVVPDGQALTKALEIAEIIAANGPLAVQAILRTIRETEGMHENEAFKIDTRIGIEVFLSDDAKEGPQAFAQKRKPNFQ 258
6 -98.900d3swxa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 36809]}  ali model 3D-neighbors follow..  23  4.TLRIRRDGYVLVIGLNRPAKRNAFDKTMLEELALALGEYETDTDLRAAVLYGEGPLFTAGLDLASVAAEIQGGASLTPE--GGINPWQVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQLEVNRGIYPFGGATIRFPRTAGWGNAMRWMLTADTFDAVEAHRIGIVQEIVPVGEHVDTAIAIAQTIARQAPLGVQATLRNARLAVREGDAAAEEQLVPTVRELFTSEDATLGVQAFLSRTTAEFV 257
7 -98.500d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  29  3.LVLSHVEGGVQVVRMNRPDKKNALIGEMYAALAEAFAKGEADDDVNVFLILGSQTDFSAGNDLPDFLTWEALSG-------SVADRFIRAVAGARKPVVAAVRGAAIGIGSTLLPHCDLVYAAPGTRFHMPFINLGIVPEAGSSQTMPALAGHRRAAEMLMLGEPFGVDTAEAVGLINGVVPGEDLEETAMAAARKLAAKPRSILVQIKALMKTPAE-PIMDRLTREAAVFDTCLKGEALNEAVSAFKEKRAPDFS 250
8 -96.300d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  28  1ADIDFRIEGHVAHVRLNRPQGLNAITQEMDDLLLDAWTEVNANSDIWAVVLSAEGKAFCIGADVSGGAERKTR-----MALGGGLTGIGGPLVTCKKPMVAAVQGFCVGGGFELAMCADIIVAADTAQFGLPETKVGIIGECGVVHRAMRQLPYHIALQLILTGERIKADEARHYGLVNEVVPFAELEEAALRWASKLNAASPLAVQAAKAAALGRLGHPLEVALMTRFEPIEEYAATEDKKEGERAAGERRKPVWT 253
9 -96.200d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  29  6.GLDVTLSDGVFSVTINRPDSLNSLTVPVITGIADAMEYAATDPEVKVVRIGGAGRGFSSGAGISADDV-SDGGGVPPDEIILEINRLVRAIAALPHPVVAVVQGPAAGVGVSIALACDVVLASENAFFMLAFTKIGLMPDGGASALVAAAVGRIRAMQMALLPERLPAAEALAWGLVTAVYPADEFEAEVDKVIARLLSGPAVAFAKTKLAINAATLTELDPALQREFDGQSVLLKSPDFVEGATA.......... 250
10 -95.900d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  25  6GRISVAIADGVASVEISNLAQRNALTKDMCLEIQELMPQLDADPDVAVVVLRGAGDTFCAGASISELASVL-LDPQPDGSTADHLSRADSAIAALSKPAVALVDGACMGGGWQIASACDFIIANERAVIGLTPAKIGIIYPRPGLERLVRLVGHANAKYILLTGQTFSAPEARALGLVADVVPSESFEEKCAALVRSLRSRSRFSMHSMKRLVDLTDSVPAAGIDQEWAAAWSAMPDSPDMGIGISAFLNREQPRFM 261
11 -95.700d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  32  7..ATSRPVAGVGLIRLDRPDALNALNQTLEAEVLDAARDFDADLEIGAIVVTGSERAFAAGADIAEMVTLTPH-----QARERNLLSGWDSLTQVRKPIVAAVAGYALGGGCELAMLCDLVIAADTARFGQPEITLGILPGLGGTQRLTRAVGKAKAMDLCLTGRSLTAEEAERVGLVSRIVPAADLLDEALAVAQRIARMSRPAGRAVKDAINEAFERPLSAGMRYERDAFYAMFDTHDQTEGMTAFLEKRTPEFT 256
12 -95.700d3tlfa_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  29  5.TIKYEVDGHTATITLNRPDALNALSPHMITELRAAYHEAENDDRVWLLVVTGTGRAFCSGADVKEIPEDGKVIYERTYDQWEAPQEGTPPFRTMAKPVLTAVNGICCGAGMDWVTTTDIVIASEQATFFDPHVSIGLVAG-RELVRVSRVLPRSIALRMALMGERMSAQRAYELGLISEIVEHDRLLERAHEIADIVNSNAPLAVRGTRLAILKGLNVPLHEAEILAETFRERVLRTEDAAEGPRAFVEKRQPNWQ 265
13 -95.700d3myba_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  31  4.LLQDRDERGVVTLTLNRPQAFNALSEAMLAALGEAFGTLAEDESVRAVVLAASGKAFCAGHDLKEMRAEPSR--EYYEKLFARCTDVMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVSGINVGLFCSTPGVA-LSRNVGRKAAFEMLVTGEFVSADDAKGLGLVNRVVAPKALDDEIEAMVSKIVAKPRAAVAMGKALFYRQIETDIESAYADAGTTMACNMMDPSALEGVSAFLEKRRPEWH 256
14 -95.400d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  24  9.RVSVTIEDHVAHVLLDRADKMNALDDAMFEGIVAAGHHLHSVKGVRCVVLSGAGRSFCAGLDLSSMGRTDRWSGERTHGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVMEVKWGLVPDMAGYALWRGNVRDDVLRELTYTHREFSGEEAVRFGFATHVAD--DPLAGAMELARVVAEKSPNAVRGAKTLSNRAPDLTVDDVLMAESIAQHELMYSRNQMEAVKAGMEKRAGDFV 266
15 -95.000d3peaa_ c.14.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}  ali model 3D-neighbors follow..  27  4.FLSVRVEDHIAVATLNHAPA-NAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFSAGADIKEFTSVT--EAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDGREGVAAFLEKRKPSFS 256
16 -94.900d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  23  12..AFAWPRPGVLEITF-RGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGVFSAGGSFGLIEEMRA-SHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKHALNHWYRSFL-PHFELSLALEFLGFSGKELEEGLKALKEKRPPEF. 262
17 -94.200d3qxza1 c.14.1.0 (A:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}  ali model 3D-neighbors follow..  29  2.ELHEEIRDGVAVLTLHGPSTRNSFTVELGRQLGAAYQRLDDDPAVRVIVLTGAPPAFCSGAQISAAAETFAAP----RNPDFSASPVQPAAFELRTPVIAAVNGHAIGIGMTLALHADIRILAEEGRYAIPQVRFGVAPDALAHWTLPRLVGTAVAAELLLTGASFSAQRAVETGLANRCLPAGKVLGAALRMAHDIATNAPESAALTKRLLWDAQMTGMSEVAARETADHLRLMGSQDAAEGPRAFIDGRPPRWA 256
18 -93.800d3rrva_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  27  6.EIDVRADGALRIITLNRPDSLNSVNDDLHVGLARLWQRLTDDPTARAAVITGAGRAFSAGGDFGYLKELSADA-DLRAKTIRDGREIVLGMARCRIPVVAAVNGPAVGLGCSLVALSDIVYIAENAYLADPHVQVGLVAADGGPLTWPLHISLLLAKEYALTGTRISAQRAVELGLANHVAD--DPVAEAIACAKKILELPQQAVESTKRVLNIHLERAVLASLDYALSAESQSFVTEDFRSIVTKLADKN..... 253
19 -93.800d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  28  1SDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGKHFSAGADLTWMQSMANFTEEENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLGLIP-AVISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLEFTLKYASQISNNAPEAVKNSKQLAQYVANKKIDEELRYTASLIAHKRVSDEGQEGLKAFLNKEIPNWN 257
20 -93.500d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  32  3.EFKVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGKAFCAGADLKERATM---AEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTEDRLEGLRAFAEKRAPVYK 256
21 -93.300d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  27  2..IGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAG-DGSARAIVLTGQGTAFCAGADLSGDAF--------AADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLAD----AQAWAAEIARLAPLAIQHAKRVLNDD--GAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKFQ 241
22 -93.100d4k29a_ c.14.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  25  4.KILYETLHGVARITLNRPERTNALDQEMLGEINAAMDAAEADAGVKAVIVRGAGNAFSSGFDLKAQMEARPAGVDAWRPLLRKDFDTVMRFWHCPKPTIAAVRGPCLAGACELALACDMTIATEDAFFGEPELKFG---AGIVVMLLPWIVGPKIAKEIILLGERVPARRAAEIGMVNRVVDGDGLDAEALRIARHIGAIDPGLVKETKRALNRALETEIDLAIEGAGSPDKIAFFEVARRDGLRAAIAWRDARFP 268
23 -92.300d4qiia_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  28  24.TYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGWAFCSGGDQRIRGRSGADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASEYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLL-DDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWS 294
24 -91.900d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  26  3.PIRLDIAAPLAEIVLNKPERRNALSVDMWAAIPGLVAEANANPDVKLILIHGGDGAFAAGADISEFETIYA-TEDAAKASGQRIAQALDAIENSEKPVIAAIEGACVGGGVSLAMAADLRVAGEGAKFGVTPGKLGLVYPAGDTRRLLAAVGPGATKDILFTGRIFTAGEAKSLGLIDRLVEKGTALEAARVWAGEIAAISQWSVRATKRMIR-GLQTGWTDETPEAQSLFLNGFANEDFKEGYRAFLDKRPAKFT 257
25 -91.300d3oc7a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}  ali model 3D-neighbors follow..  25  8.AGPAATGGPVARLTLNSPHNRNALSTALVSQLHQGLRDASSDPAVRVVVLAHTGGTFCAGADLSEAGSGGSPSSDMAVERAREMAALMRAIVESRLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSFALTEARIGVAPAIISLTLLPK-LSARAAARYYLTGEKFDARRAEEIGLITMAAE--DLDAAIDQLVTDVGRGSPQGLAASKALTTAAVLERFDRDAERLAEESARLFVSDEAREGMLAFLEKRSPNW. 261
26 -90.800d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  23  6..QVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGDDRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFPDDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSKSI 270
27 -90.800d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  28  3.HLNANLEGGVLTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEHDFTAGNDMKDFMGFV-QNPNAGPAGQVPPFVLLKSAARLSKPLIIAVKGVAIGIGVTILLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVE--DAYATAQATAQHLTALPLASLKQTKALMKHDLD-QIIECIDHEAEIFMQRVQSPEMLEAVQAFM........ 246
28 -90.500d4k3wa_ c.14.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}  ali model 3D-neighbors follow..  28  3.TLILEKQGPTLVITINRPDVRNAMSLQMVAELSTIFSEIENDISIRAAVLRGAGGHFCAGGDIKDMAGARSQKAGEGYKLNRAFGQMIQQVNESSKVVIAITEGAVMGGGFGLACVSDLAIAGPTAKFGMPETTLGVIPAQIAPFVVER-IGLTQARRLALLGLRIDATEACKLGIVHQVAESEEQLSDMLQALERVRLCAPDATAETKALLHRVGHEAMAGLLDDAAEKFAAAIRGPEGAEGTMAFMQKREPKWA 263
29 -90.300d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  25  2.SLRLERDGAVARLLIDRADRRNAFSLDMWQRLPELLAEASGDDALRVLVVKSANGAFCAGADIAELLANKD-DAAFHAANQQAINRAQYELARFRLPTVAMVEGDCIGGGCGIALACDMRIAAPAARFGITPAKLGLVYPLHDVKLLVDLVGPGQARRLMFTGGLIDANEAHRIGLVELLGESEDA------LVGQLATVSSFSTQAIKSFVRRVLDGQVADDAD-SLRVFASAFEGADFREGTGAFLEKRPPVF. 249
30 -89.900d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  23  5.YVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGKVFSAGHDIHELPSGGRDP----LSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFEQGMRRAVYDSEDYQEGMNAFLEKRKPNFV 259
31 -89.900d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  25  4.VIQLVREGAIATVTLNRPDRMNALNLPMWRGLAEAFETISADRSIHVVILRGAGKAFAPGADIEEFDTLRA-NAEQAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGLELACCCDIRLSAKSGKFGVPINKISVVMAYPELAQIRRVAGPAAALEILLEGRIMDADEAAAKRLVNRVVEDDAMDAEVAATAKRIAAGAPLANRWHKAFIARLDDPTPVSEAELDE--CYRFLDTKDYAEGLAAFRAKRKPVFT 257
32 -89.900d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  4.DIVVRKQDGFTHILLSKSSENNSLNPEVMREVQSALSTAAAD-DSKLVLLSAVGSVFCCGLDFIYFIRRTDDRKRESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDE.. 258
33 -89.600d2q35a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}  ali model 3D-neighbors follow..  21  2.VQLTELGNGVVQITMKDESSRNGFSPSIVEGLRHCFSVVAQNQQYKVVILTGYGNYFSSGASKEFLIRKTRGEVE--------VLDLSGLILDCEIPIIAAMQGHSFGGGLLLGLYADFVVFSQESVYATNFMKYGFTPVGATSLILREKLGSELAQEMIYTGENYRGKELAERGIPFPVVSRQDVLNYAQQLGQKIAKSPRLSLVALKQHLSADIKAKFPEAIKKELEIHQVTFNQPEIASRIQQEF........ 241
34 -88.100d2ppya_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}  ali model 3D-neighbors follow..  24  9.YLTVFKEDGIAEIHLHINK-SNSYDLEFYKEFNAAIDDIRFDPDIKVVIVMSDVKFFSAGADINFLRSA---DPRFKTQFCLFCNETLDKIARSPQVYIACLEGHTVGGGLEMALACDLRFMGDEAKIGLPEVSLGVLAGTGGTQRLARLIGYSRALDMNITGETITPQEALEIGLVNRVFPQAETRERTREYARKLANSATYAVSNIKLAIMNGKEMPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNWK 262
35 -87.800d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  26  3..VEIERRGDASLIVLSRPEKLNAINLEMLADLADQFSKAEKE-DTRVIVITGYGKNFSAGADINMLASF---DPASAYSFRLKMNSIAQRIRKSDKPVIALLKGYSMGGGLELAESADIRIAMSDAVIGQPESSIGINAGAGGNVILPKLVGRGSAAYLAMSGKKLNAQEAMALGLVDEVVDDEA---KAWKIIDDICKKPKKTLQFIKRAINSSYDMGLESAMDQEALYFSLLFTDPEVLDALSKWRK....... 243
36 -87.400d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  24  8.TVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKL-------DQSRLLDT.......... 248
37 -86.800d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  24  3.PVRIERNGPVTTVIIDRPEARNAVNGPTAAALFAAFEEFDADDTASVAVLTGANGTFCAGADLKAFGTPEAN-----QVHREGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVVDEDATMGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDLILTGRAVDAAEAYAIGLANRVVPTGQARQAAEELAADLARLPQQCMRADRLSALHQWGESENAAMDFEFASI......................... 228
38 -86.500d5e0nx_ c.14.1.0 (X:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  28  4.VLLDRSRPGVALVTLNRPERMNSMAFDVMVPLLELLGDLRHDNSVRVVILTGAGRGFSSGADHKSAGSVPHTRPTYALRSMEVLDNVILALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYFRAAGINNGLTAELGLSYLLPRAIGTSRAFEIMLTGRDVDAAEAERIGLVSRTVPDDDLLETCFEMAQRMRGFSRPGIELTKRTLWSGLDASLEGHMQAE............................. 236
39 -85.200d3pe8a_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  29  3.VLLVDTTDRVRTLTLNRPQSRNALSAELRSTFFRALSDAQNDDDVDVVIVTGADPVFCAGLDLKELGDTTE------------LPDISPKWPDMTKPVIGAINGAAVTGGLELALYCDILIASENAKFADTHARVGLMPTWGLSVRLPQKVGVGLARRMSLTGDYLSAQDALRAGLVTEVVAHDDLLTAARRVAASIVGNNQKAVRALLDSYHRIDALQTGGALWAEAEAARQWMRST.................. 228
40 -84.700d3h0ua1 c.14.1.0 (A:8-283) automated matches {Streptomyces avermitilis [TaxId: 33903]}  ali model 3D-neighbors follow..  21  6.TIKARLDGTVLSATFNAPP-MNLIGPEVVRDLVALLEELAHPTAPRVVIFDSADDFFFPHVDMTKVPEYTAEAAKAGGPGDASLGMLFRKLSQLPAVTIAKLRGRARGAGSEFLLACDMRFASENAILGQPEVGIGAPPGAGAIQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKSAIN-AISLPAPAEVRADAALFQQLVRGEKVQQRTAELFKQGFQTRG 261
41 -84.700d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}  ali model 3D-neighbors follow..  23  1.DVLFSNHGRVAVITLNRPERLNAWTTPMRETIIDALERFNRDPEVAAIIMTGAGRAFSAGQDLSEAHDF---DGERAVAWVKEWQRYYTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRMGQPEINAGI-ASTTGPWIMNAMLGMSRTIELTLTGRLMEAEECHRIGLIHHLVDEDKVFDKALEIATELAAKPPVAMRLDKQRFREMTEPGFIDCIEAGERI.......................... 227
42 -84.700d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  24  2..VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGARSFSAGGDFNEVKQLS--RSEDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKRAVNKPFIHLLEQTRDASKAVH......................... 229
43 -83.700d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  4.TLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSII-TVLTGNGDYYSSGNDLTNFTDIPPGGEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDECTN.............. 245
44 -83.300d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  21  4.TIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCE-TSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQ-ASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPA-CVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVL--LRKHLLRLRRLNKKGIAHYKQFMS-SLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQ.... 249
45 -80.300d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  20  10..DLDLRDNGVCVVTLNRPDKRNALDVATIEELVTFFSTAH-RKGVRAVVLTGAGDHFCAGLDLVEHWKA-DRSADDFMHVCLRWHEAFNKMEYGGVPIIAALRGAVVGGGLELASAAHLRVMDQSTYFALPEGQRGIFTGGGATIRVSDMIGKYRMIDMILTGRVYQGQEAADLGLAQYITEGSSF-DKAMELADKIASNLPLTNFAICSAISHMQNMSGLDAAYAEAFVGGIVNTQPAA................ 245
46 -78.600d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  23  13.LSQDGTTQGGTVATLTLAAKMGSMGPAFWQEFPQALSE---LGDARVLIVRGE-QVFSAGLDVKSNGAAALGKPDAFKAVVDEMHAVTEGLAALPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLPEVKLGITADLGGLQRLPHLIGRGRTAHLALTGEAIDAATAERWGLVTEVLPDDALFARAEALAEHLAALPAKALEGTKRALSDGL--PHAESLAAAVRWNAEHMTVEALQAG............. 253
47 -78.200d1hnua_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  3.KISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKAQGDDTNKYSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSNDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLK---RFRQ....... 263
48 -76.800d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  19  5.LVEPDAGAGVAVMKFKNPP-VNSLSLEFLTELVISLEKLENDKSFRGVILTSDRGVFSAGLDLTEMCGR---SPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQ........... 248
49 -75.800d2j5ga_ c.14.1.0 (A:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}  ali model 3D-neighbors follow..  17  12..HFHRDENGILEVRMHTNGSSLVFTGKTHREFPDAFYDISRDRDNRVVILTGSGDAWMAEIDFPSLGDVT--NPREWDKTYWEGKKVLQNLLDIEVPVISAVNGAALL-HSEYILTTDIILASENTVFDMPHLNAGIVPGDGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVALTQRLKRLVNEGIGYGLALEGITATDLRNT............... 249
50 -67.600d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}  ali model 3D-neighbors follow..  20  12.....ALESGIVELKFDLKESVNKFNRLTLNELRQAVDAIKADASVKGVIVSSGKDVFIVGADITEFVENFKLPDAELIAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDLIKRAISGELDAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSASNCLIGLFLNDQELK.. 301
51 -10.900d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  14  84GTI----LGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSG-----GARIQEGIDSLSGYGKMFFANVKLSGVV---------PQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFIT----------------PQVIKSVTGEDVTADELGGAEAHMAISGNIHFVAEDDD---AAELIAKKLLSFLP...................................................... 250
52 -10.300d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  100.....RVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCS-----GVEFPNQDKVYPNRRGGGTPFFR-----NSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGI----SGMNPKGYIDDEAAEQIIAAQIENSKLKVPAYDETGFFREVYQNDL---GVIDGIKKYISYLP...................................................... 288
53 -10.200d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  91GTL----YGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASG-----GARMQE--------ALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSSFAMLGDLNIAEPKALIGF-----------AGPRVIEQTVREKLPPGF-------RSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPA...................................................... 260
54 -9.190d2f6ia1 c.14.1.1 (A:179-366) Clp protease, ClpP subunit {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}  ali model 3D-neighbors follow..  23......................DEINKKTADELISQLLYLDNINHNDIIYINSPGGSINEGLAI------------------------LDIFNYIKSDIQTISFGLVASMASVILASGK-RKSLPNCRIMIHQPLGNAFGHPQDIEIQTKEILYLKKLLYHYLSSFMNALEAKQYGIIDEVIETKLPHPY................................................................... 186
55 -9.080d1yg6a_ c.14.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  33......................GQVEDHMANLIVAQMLFLEAENPEKDIYL-------SPGGVITA--------------------SIYDTMQFIKPDVSTICMGQAASMGAFLLTA-GKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHLSAPEAVEYGLVDSILTHRN....................................................................... 193

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.