current user: public

If you have questions about the server, please let us know.

Query: d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MTYQSIRLTQRPLSQDGTTQGGTVATLTLAAKMGSMGPAFWQEFPQALSELGDARVLIVRGEQVFSAGLDVKSNGAAIVPALGKPDAFKAVVDEMHAVTEGLAALPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLPEVKLGITADLGGLQRLPHLIGRGRTAHLALTGEAIDAATAERWGLVTEVLPDQDALFARAEALAEHLAALPAKALEGTKRALSDGLPHAESLAAAVRWNAEHMTVEALQAGLast
1 -101.000d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors  100  1MTYQSIRLTQRPLSQDGTTQGGTVATLTLAAKMGSMGPAFWQEFPQALSELGDARVLIVRGEQVFSAGLDVKSNGAAIVPALGKPDAFKAVVDEMHAVTEGLAALPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLPEVKLGITADLGGLQRLPHLIGRGRTAHLALTGEAIDAATAERWGLVTEVLPDQDALFARAEALAEHLAALPAKALEGTKRALSDGLPHAESLAAAVRWNAEHMTVEALQAG 253
2 -83.500d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  31  1.AYESIQVT-------SAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKDSDCRAVVVSGAKMFTSGIDLMDMASDILQPPGDDVALRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDVDESLDYMATWNMSMLQTQDIIKS 257
3 -81.900d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  27  2............LVEIERRGDASLIVLSRPEKLNAINLEMLADLADQFSEKEDTRVIVITGYKNFSAGADINMLASF------DPASAYSFRLKMNSIAQRIRKSDKPVIALLKGYSMGGGLELAESADIRIAMSDAVIGQPESSIGINAGAGGNVILPKLVGRGSAAYLAMSGKKLNAQEAMALGLVDEVVDDEAK----AWKIIDDICKKPKKTLQFIKRAINSSYDLESAMDQEALYFSLLFTDPEVLDA 237
4 -81.700d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  26  4.......MNFHDRVSVTIEDHVAHVLLDRADKMNALDDAMFEGIVAALHSVKGVRCVVLSGARSFCAGLDLSSMGRTDRWSGNSTERTHGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVMEVKWGLVPDMAGYALWRGNVRDDVLRELTYTHREFSGEEAVRFGFATHVADD---PLAGAMELARVVAEKSPNAVRGAKTLSNRAPDVDDVLMAESIAQHELMYSRNQMEA 253
5 -81.600d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  25  2.TYTTIATSR-------PVAGVGLIRLDRPDALNALNQTLEAEVLDAARDDLEIGAIVVTGSRAFAAGADIAEMVTLTPHQA--------RERNLLSGWDSLTQVRKPIVAAVAGYALGGGCELAMLCDLVIAADTARFGQPEITLGILPGLGGTQRLTRAVGKAKAMDLCLTGRSLTAEEAERVGLVSRIVPA-ADLLDEALAVAQRIARMSRPAGRAVKDAINEAFELSAGMRYERDAFYAMFDTHDQTEG 243
6 -81.400d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  28  2...........PEFKVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRSRDVRAVVITGAKAFCAGADLKERATM------AEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPE-GHLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLDDALALELRKYEEILKTEDRLEG 243
7 -80.500d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  26  1............MIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKDGSARAIVLTGQTAFCAGADLSGDAFA-----------ADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLAD-----AQAWAAEIARLAPLAIQHAKRVLNDDGAIEEAWPAHKELFDKAWGSQDVIEA 228
8 -80.300d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  25  1...........ADIDFRIEGHVAHVRLNRPQGLNAITQEMDDLLLDAWTENSDIWAVVLSGEKAFCIGADVSGGAERKTRM--------ALGGGLTGIGGPLVTCKKPMVAAVQGFCVGGGFELAMCADIIVAADTAQFGLPETKVGIIGECGVVHRAMRQLPYHIALQLILTGERIKADEARHYGLVNEVVP-FAELEEAALRWASKLNAASPLAVQAAKAAALGRLGLEVALMTRFEPIEEYAATEDKKEG 240
9 -80.200d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  26  4SGYSNLDLDLR-------DNGVCVVTLNRPDKRNALDVATIEELVTFFSHRKGVRAVVLTGADHFCAGLDLVEHWKAD----RSADDFMHVCLRWHEAFNKMEYGGVPIIAALRGAVVGGGLELASAAHLRVMDQSTYFALPEGQRGIFTGGGATIRVSDMIGKYRMIDMILTGRVYQGQEAADLGLAQYITE--GSSFDKAMELADKIASNLPLTNFAICSAISHMQNGLDAAYAEAFVGGIVNTQPAA... 245
10 -80.000d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  23  2..........SDVIQLVREGAIATVTLNRPDRMNALNLPMWRGLAEAFETDRSIHVVILRGAKAFAPGADIEEFDTLR----ANAEQAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGLELACCCDIRLSAKSGKFGVPINKISVVMAYPELAQIRRVAGPAAALEILLEGRIMDADEAAAKRLVNRVVED-DAMDAEVAATAKRIAAGAPLANRWHKAFIARLDDPTPVSEAELDECYRFLDTKDYAEG 244
11 -80.000d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  20  4........GRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETDPAAGVLVLTGAEAWTAGMDLKEYFREVDAGPEILQE-KIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPL-AQLREVTIELARNLLEKNPVVLRAAKHGFKRCREWEQNEDYLYAKLDQSRLLD..... 247
12 -79.900d3peaa_ c.14.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}  ali model 3D-neighbors follow..  24  3...........KFLSVRVEDHIAVATLNHAPA-NAMSSQVMHDVTELIDQDDNIRVVVIHGERFFSAGADIKEFTSVT-----EAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAE-ETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSYYEGVQREAQIFGEVFTSEDGREG 243
13 -79.800d3swxa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 36809]}  ali model 3D-neighbors follow..  25  1.........DYETLRIRRDGYVLVIGLNRPAKRNAFDKTMLEELALALETDTDLRAAVLYGEPLFTAGLDLASVAAEIQGGASLTPE-----GGINPWQVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQLEVNRGIYPFGGATIRFPRTAGWGNAMRWMLTADTFDAVEAHRIGIVQEIVPV-GEHVDTAIAIAQTIARQAPLGVQATLRNARLAVRDAAAEEQLVPTVRELFTSEDATLG 244
14 -79.800d4f47a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  24  2...........PDALVEQRGHTLIVTMNRPSRRNALSGEMMQIMVEAWDNDPDIRCCILTGAGYFCAGMDLKAATKKPPGDSFKD---GSYDPSRIDALLKGRRLKKPLIAAVEGPAIAGGTEILQGTDIRVAAESAKFGISEAKWSLYPMGGSAVRLVRQIPYTVACDLLLTGRHITAAEAKEMGLVGHVVPD-GQALTKALEIAEIIAANGPLAVQAILRTIRETMHENEAFKIDTRIGIEVFLSDDAKEG 245
15 -79.800d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  24  1.......LAPVAGLDVTLSDGVFSVTINRPDSLNSLTVPVITGIADAMEYDPEVKVVRIGGARGFSSGAGISADDVSD----GGGVPPDEIILEINRLVRAIAALPHPVVAVVQGPAAGVGVSIALACDVVLASENAFFMLAFTKIGLMPDGGASALVAAAVGRIRAMQMALLPERLPAAEALAWGLVTAVYPA-DEFEAEVDKVIARLLSGPAVAFAKTKLAINAATELDPALQREFDGQSVLLKSPDFVEG 247
16 -79.600d3rrva_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  25  1.......YDMPTEIDVRADGALRIITLNRPDSLNSVNDDLHVGLARLWQRDPTARAAVITGARAFSAGGDFGYLKELS----ADADLRAKTIRDGREIVLGMARCRIPVVAAVNGPAVGLGCSLVALSDIVYIAENAYLADPHVQVGLVAADGGPLTWPLHISLLLAKEYALTGTRISAQRAVELGLANHVADD---PVAEAIACAKKILELPQQAVESTKRVLNIHLEVLASLDYALSAESQSFVTEDFRSI 245
17 -79.600d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  21  4.........RTGRISVAIADGVASVEISNLAQRNALTKDMCLEIQELMPQDPDVAVVVLRGADTFCAGASISELASVL----LDPQPDGSTADHLSRADSAIAALSKPAVALVDGACMGGGWQIASACDFIIANERAVIGLTPAKIGIIYPRPGLERLVRLVGHANAKYILLTGQTFSAPEARALGLVADVVPS-ESFEEKCAALVRSLRSRSRFSMHSMKRLVDLTVPAAGIDQEWAAAWSAMPDSPDMGIG 248
18 -79.400d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  22  2...........LPIRLDIAAPLAEIVLNKPERRNALSVDMWAAIPGLVAENPDVKLILIHGGGAFAAGADISEFETIY----ATEDAAKASGQRIAQALDAIENSEKPVIAAIEGACVGGGVSLAMAADLRVAGEGAKFGVTPGKLGLVYPAGDTRRLLAAVGPGATKDILFTGRIFTAGEAKSLGLIDRLVEK-GTALEAARVWAGEIAAISQWSVRATKRMIRGQTGWTDETPEAQSLFLNGFANEDFKEG 244
19 -79.000d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}  ali model 3D-neighbors follow..  28  2...........DTLDFEVVNNVGWIRMNRAAKHNPFDAELRADLMTVLERDADIRVLVLTSHGSFCAGGNLHVLRDNLDS---GPAYWQQRIKTGLRFIHDMLNLGRPVIAAVDGPAFGAGFALSLTADIVLASPRARFSMAYLRLGLVPDLGALYLLPRAVGLQRAKELMFSTRELDAEEAHRLGLVMEVHES-EALEQRAREIAESLVQAAPTALALTKAALNVSLDEQTMFSLEAASQAAAFSTKEPRAA 245
20 -78.800d3gowa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  28  1............MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEDREVRALLLTGARAFSAGQDLTEFGD-------RKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPA-EKLMEEALSLAKELAQGPTRAYALTKKLLLETYSLTEALALEAVLQGQAGQTQDHEEG 239
21 -78.600d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  23  2............AIKSTSEGQTLILTLSNPEFRNALGPEIYAAGIEALNANPEIRSVVITGEAVFCAGGNLQRLQAN---RREAPEVQAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMSYSTVGLSPDGGGSWSLARSLPRALASELLMGGERISAQRLHDLGLVNKVASA-GDALSEALRMAGQLNARAPNALASIKELINEASTLSQQLACERDHFVRNLHHSNGGEG 244
22 -78.300d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  22  1MSYQYVNVV--------TINKVAVIEFNYGRKLNALSKVFIDDLMQALSDPEIRCIILRAGSKVFSAGHDIHELPSGGRDP-------LSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEV-EELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHDEFERIQGMRRAVYDSEDYQEG 246
23 -78.200d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  26  1..........SEPVRIERNGPVTTVIIDRPEARNAVNGPTAAALFAAFDADDTASVAVLTGAGTFCAGADLKAFG--------TPEANQVHREGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVVDEDATMGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDLILTGRAVDAAEAYAIGLANRVVPT-GQARQAAEELAADLARLPQQCMRADRLSALHQESENAAMDFEFASI............ 228
24 -78.100d3pe8a_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  28  1..........SPVLLVDTTDRVRTLTLNRPQSRNALSAELRSTFFRALSDDDDVDVVIVTGAPVFCAGLDLKELGDT---------------TELPDISPKWPDMTKPVIGAINGAAVTGGLELALYCDILIASENAKFADTHARVGLMPTWGLSVRLPQKVGVGLARRMSLTGDYLSAQDALRAGLVTEVVAH-DDLLTAARRVAASIVGNNQKAVRALLDSYHRILQTGGALWAEAEAARQWMRST..... 228
25 -78.000d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}  ali model 3D-neighbors follow..  23  2..........YEAIGHRVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRDDSVGAVMITGADAFCAGFYLREIPLDKGVA-GVRDHFRIAALWWHQMIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCAWHTIGIGNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPK-DEFREVAWKVARELAAAPTHLQVMAKERFHAGWPVEECTEFEIQNVIASVTHPHFMPC 248
26 -77.900d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  27  1..........HPHLNANLEGGVLTLAINRPEAKNALYGELYLWIAKALDENKDVRVVVLRGAHDFTAGNDMKDFMGFV----QNPNAGPAGQVPPFVLLKSAARLSKPLIIAVKGVAIGIGVTILLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVED---AYATAQATAQHLTALPLASLKQTKALMKHDLDIIECIDHEAEIFMQRVQSPEMLEA 241
27 -77.800d3qxza1 c.14.1.0 (A:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}  ali model 3D-neighbors follow..  24  1...........TELHEEIRDGVAVLTLHGPSTRNSFTVELGRQLGAAYQRDPAVRVIVLTGAPAFCSGAQISAAAETFAAP-------RNPDFSASPVQPAAFELRTPVIAAVNGHAIGIGMTLALHADIRILAEEGRYAIPQVRFGVAPDALAHWTLPRLVGTAVAAELLLTGASFSAQRAVETGLANRCLPA-GKVLGAALRMAHDIATNAPESAALTKRLLWDAMSAAEVAARETADHLRLMGSQDAAEG 243
28 -77.400d5e0nx_ c.14.1.0 (X:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  33  1.........TRFVLLDRSRPGVALVTLNRPERMNSMAFDVMVPLLELLGDDNSVRVVILTGARGFSSGADHKSAGSVPVDGLTRPTYALRSMEVLDNVILALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYFRAAGINNGLTAELGLSYLLPRAIGTSRAFEIMLTGRDVDAAEAERIGLVSRTVPD-DDLLETCFEMAQRMRGFSRPGIELTKRTLWSGLDLEGHMQAE................ 236
29 -77.300d2ppya_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}  ali model 3D-neighbors follow..  27  1....TAVETKKQYLTVFKEDGIAEIHLHINK-SNSYDLEFYKEFNAAIDDDPDIKVVIVMSDKFFSAGADINFLRSA------DPRFKTQFCLFCNETLDKIARSPQVYIACLEGHTVGGGLEMALACDLRFMGDEAKIGLPEVSLGVLAGTGGTQRLARLIGYSRALDMNITGETITPQEALEIGLVNRVFPQ-AETRERTREYARKLANSATYAVSNIKLAIMNGKELNVAIRYEGELQNLLFRSEDAKEG 249
30 -77.200d3tlfa_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  24  1........DSFDTIKYEVDGHTATITLNRPDALNALSPHMITELRAAYHEDDRVWLLVVTGTRAFCSGADVKEIPEDGKVIYERPLSTYDQWEAPQEGTPPFRTMAKPVLTAVNGICCGAGMDWVTTTDIVIASEQATFFDPHVSIGLVAG-RELVRVSRVLPRSIALRMALMGERMSAQRAYELGLISEIVEH-DRLLERAHEIADIVNSNAPLAVRGTRLAILKGLNLHEAEILAETFRERVLRTEDAAEG 252
31 -77.100d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  26  1..........SELVLSHVEGGVQVVRMNRPDKKNALIGEMYAALAEAFAKDDDVNVFLILGSTDFSAGNDLPDFLTWEALSG----------SVADRFIRAVAGARKPVVAAVRGAAIGIGSTLLPHCDLVYAAPGTRFHMPFINLGIVPEAGSSQTMPALAGHRRAAEMLMLGEPFGVDTAEAVGLINGVVPG-EDLEETAMAAARKLAAKPRSILVQIKALMKTPAPIMDRLTREAAVFDTCLKGEALNEA 237
32 -76.600d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}  ali model 3D-neighbors follow..  23  2.............VLFSNHGRVAVITLNRPERLNAWTTPMRETIIDALERDPEVAAIIMTGARAFSAGQDLSEAHDF------DGERAVAWVKEWQRYYTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRMGQPEINAGI-ASTTGPWIMNAMLGMSRTIELTLTGRLMEAEECHRIGLIHHLVDE-DKVFDKALEIATELAAKPPVAMRLDKQRFREMTEFIDCIEAGERI............. 227
33 -76.500d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  24  1............MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARDDSVRAVVVYGGRSFSAGGDFNEVKQLS-----RSEDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVES-SALLDAAITQAHVMASYPASAFINTKRAVNKPFILEQTRDASKAVH............ 229
34 -76.400d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  25  2............SLRLERDGAVARLLIDRADRRNAFSLDMWQRLPELLAEDDALRVLVVKSAGAFCAGADIAELLANK----DDAAFHAANQQAINRAQYELARFRLPTVAMVEGDCIGGGCGIALACDMRIAAPAARFGITPAKLGLVYPLHDVKLLVDLVGPGQARRLMFTGGLIDANEAHRIGLVELLGESEDAL-------VGQLATVSSFSTQAIKSFVRRVLDGQADDADSLRVFASAFEGADFREG 237
35 -76.200d4qiia_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  18  21.........TDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHSPDVGVVLLTGNWAFCSGGDQRIRGRSGYQYASGDDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASEYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEH-AELETVGLQWAAEINAKSPQAQRMLKFAFNLLDGLVGQQLFAGEATRLAYMTDEAVEG 281
36 -76.000d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  25  6ARYPGLAFAW-------PRPGVLEITF-RGEKLNAMPPALHRGLARVWRDVEGVRAVLLRGEGVFSAGGSFGLIEEMR----ASHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVED-EKVYEKALEVAERLAQGPKEALHHTKHALNHWYRSFPHFELSLALEFLGFSGKELEEG 250
37 -75.900d3myba_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  25  1.........EPLLLQDRDERGVVTLTLNRPQAFNALSEAMLAALGEAFGTDESVRAVVLAASKAFCAGHDLKEMRAE-----PSREYYEKLFARCTDVMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVSGINVGLFCSTPGVA-LSRNVGRKAAFEMLVTGEFVSADDAKGLGLVNRVVAP-KALDDEIEAMVSKIVAKPRAAVAMGKALFYRQTDIESAYADAGTTMACNMMDPSALEG 243
38 -75.600d4k3wa_ c.14.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}  ali model 3D-neighbors follow..  23  1..........CETLILEKQGPTLVITINRPDVRNAMSLQMVAELSTIFSEDISIRAAVLRGAGHFCAGGDIKDMAGARSQKAGEDDPFYKLNRAFGQMIQQVNESSKVVIAITEGAVMGGGFGLACVSDLAIAGPTAKFGMPETTLGVIPAQIAPFVVER-IGLTQARRLALLGLRIDATEACKLGIVHQVAESEEQLSDMLNQALERVRLCAPDATAETKALLHRVEAMAGLLDDAAEKFAAAIRGPEGAEG 250
39 -74.400d3oc7a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}  ali model 3D-neighbors follow..  21  1.....MDALVDYAGPAATGGPVARLTLNSPHNRNALSTALVSQLHQGLRDDPAVRVVVLAHTGTFCAGADLSEAGSGGSPS-SAYDMAVERAREMAALMRAIVESRLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSFALTEARIGVAPAIISLTLLPK-LSARAAARYYLTGEKFDARRAEEIGLITMAAED---LDAAIDQLVTDVGRGSPQGLAASKALTTAAVRFDRDAERLAEESARLFVSDEAREG 249
40 -74.300d4k29a_ c.14.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  25  1.........TYSKILYETLHGVARITLNRPERTNALDQEMLGEINAAMDADAGVKAVIVRGANAFSSGFDLKAQMEA---RPAGVDAWRPLLRKDFDTVMRFWHCPKPTIAAVRGPCLAGACELALACDMTIATEDAFFGEPELKFG---AGIVVMLLPWIVGPKIAKEIILLGERVPARRAAEIGMVNRVVDG-DGLDAEALRIARHIGAIDPGLVKETKRALNRALEIDLAIEGAGSPDKIAFFEVARRDG 255
41 -73.700d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  21  1...........SDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSDTNVRVIVLKANKHFSAGADLTWMQSM---ANFTEEENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLGLIPA-VISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPD-DTLLEFTLKYASQISNNAPEAVKNSKQLAQYVANKEELVRYTASLIAHKRVSDEGQEG 244
42 -73.400d2q35a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}  ali model 3D-neighbors follow..  18  2............VQLTELGNGVVQITMKDESSRNGFSPSIVEGLRHCFSVNQQYKVVILTGYNYFSSGASKEFLIRKTRGEV-----------EVLDLSGLILDCEIPIIAAMQGHSFGGGLLLGLYADFVVFSQESVYATNFMKYGFTPVGATSLILREKLGSELAQEMIYTGENYRGKELAERGIPFPVVSR-QDVLNYAQQLGQKIAKSPRLSLVALKQHLSADIKFPEAIKKELEIHQVTFNQPEIASR 236
43 -73.100d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  3...........ETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALSKDDSIITVLTGNGDYYSSGNDLTNFTDI--PPGGVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPD-STFQKEVWTRLKAFAKLPPNALRISKEVIRKREKLHAVNAEECNVLQGRWLSDECTN. 245
44 -73.000d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1.........RYRDIVVRKQDGFTHILLSKSSENNSLNPEVMREVQSALSAADDSKLVLLSAVSVFCCGLDFIYFIRRLTDD--RKRESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWP-GTFTQEVMVRIKELASCNPVVLEESKALVRCNMELEQANERECEVLKKIWGSAQGMDS 247
45 -72.800d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  20  1.........TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNETSTVTVVVLEGLEVFCFGADFQEIYQEM----KRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPA-CVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLR---KHLLRLRRLNKKGIAHYKQFMSSDHQVSRAKATALTANQDMFSDPQNQMG 240
46 -72.300d3h0ua1 c.14.1.0 (A:8-283) automated matches {Streptomyces avermitilis [TaxId: 33903]}  ali model 3D-neighbors follow..  25  2ASYETIKAR--------LDGTVLSATFNAPP-MNLIGPEVVRDLVALLEEPTAPRVVIFDSADFFFPHVDMTKVPEYTAE---AAKAGGPGDASLGMLFRKLSQLPAVTIAKLRGRARGAGSEFLLACDMRFASENAILGQPEVGIGAPPGAGAIQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNRAVPD-AELDEFVAGIAARMSGFPRDALIAAKSAINASLPAPAEVRADAALFQQLVRGEKVQQR 248
47 -71.000d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  21  1........SQRVLVEPDAGAGVAVMKFKNPP-VNSLSLEFLTELVISLEKDKSFRGVILTSDGVFSAGLDLTEMCGR------SPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPE-EQVQSTALSAIAQWMAIPDHARQLTKAMMRKATRLVTQRDADVQNFVSFISKDSIQKS 246
48 -69.800d2j5ga_ c.14.1.0 (A:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}  ali model 3D-neighbors follow..  25  6TKYENLHFHRD-------ENGILEVRMHTNGSSLVFTGKTHREFPDAFYDDRDNRVVILTGSDAWMAEIDFPSLGDVT-----NPREWDKTYWEGKKVLQNLLDIEVPVISAVNGAALLHS-EYILTTDIILASENTVFDMPHLNAGIVPGDGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQ-SKLMERAWEIARTLAKQPTLNLRYTRVALTQRLKVNEGIGYGLALEGITATDLRNT.. 249
49 -67.100d1hnua_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  15  1..........NEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLDRNRDVYFTIIQSSRFFSSGADFKGIAKAQGDDTNKYPSVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSNDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEALEELREKVKGLYLPSCLGMKKLLKSNHAFNKANSVEVNESLKYWVDGEPLKR 260
50 -61.100d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}  ali model 3D-neighbors follow..  22  1.....MIYEGKAITVTALESGIVELKFDLKESVNKFNRLTLNELRQAVDADASVKGVIVSSGDVFIVGADITEFVENFKL---PDAELIAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVT-ADKLGAAALDLIKRAISGEL-APVEAIKTIQKAFGRDKALEVEAAGFAKLAKTSASNC. 289
51 -11.300d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  10  106.....................VYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIY-----CSGVEFPNQDKVYPNRRGGGTPFFRN--------SELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGI----SGMNPKGYIDDEAAEQIIAAQIENSKLKVPAYDETGFFREVYQNDLGVIDGIKKYISYLPA.......................................... 289
52 -11.100d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  16  91.....................VHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLF-----SGGARIQEGIDSLSGYGKMFFANVKLSGVV------------PQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFIT----------------PQVIKSVTGEDVTADELGGAEAHMAISGNIHFVAEDDDAAELIAKKLLSFLPQNN........................................ 253
53 -9.710d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  98.....................VVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLIC-----SGGARMQEALMSLMQ-----------MAKTSAALAKMQERGLPYISVLTDPTMGGVSSFAMLGDLNIAEPKALIGF-----------AGPRVIEQTVREKLPPGF-------RSEFLIEKGAIDMIVRRPELKLASILAKLMNLPAPNP....................................... 263
54 -9.290d3tdca1 c.14.1.0 (A:1719-2042) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  233...........................................................................................................VTISLVTCRAIGIGAYLVRLGQRVIQVENSHIIL-----------TGASALNKVLGREVYTSNNQLG---GVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDN........................................ 324

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.