current user: public

If you have questions about the server, please let us know.

Query: d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst SEPVRIERNGPVTTVIIDRPEARNAVNGPTAAALFAAFEEFDADDTASVAVLTGANGTFCAGADLKAFGTPEANQVHREGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVVDEDATMGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDLILTGRAVDAAEAYAIGLANRVVPTGQARQAAEELAADLARLPQQCMRADRLSALHQWGESENAAMDFEFASILast
1 -102.000d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors  100  1SEPVRIERNGPVTTVIIDRPEARNAVNGPTAAALFAAFEEFDADDTASVAVLTGANGTFCAGADLKAFGTPEANQVHREGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVVDEDATMGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDLILTGRAVDAAEAYAIGLANRVVPTGQARQAAEELAADLARLPQQCMRADRLSALHQWGESENAAMDFEFASI 228
2 -93.100d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  27  7.KTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKL 240
3 -92.100d3pe8a_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  33  1SPVLLVDTTDRVRTLTLNRPQSRNALSAELRSTFFRALSDAQNDDDVDVVIVTGADPVFCAGLDLKELGDTTELP-------DISPKWPDMTKPVIGAINGAAVTGGLELALYCDILIASENAKFADTHARVGLMPTWGLSVRLPQKVGVGLARRMSLTGDYLSAQDALRAGLVTEVVAHDDLLTAARRVAASIVGNNQKAVRALLDSYHRIDALQTGGALWAEAEAA 221
4 -91.300d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  33  7...ATSRPVAGVGLIRLDRPDALNALNQTLEAEVLDAARDFDADLEIGAIVVTGSERAFAAGADIAEMVTLTPHQARERNLLSGWDSLTQVRKPIVAAVAGYALGGGCELAMLCDLVIAADTARFGQPEITLGILPGLGGTQRLTRAVGKAKAMDLCLTGRSLTAEEAERVGLVSRIVPAADLLDEALAVAQRIARMSRPAGRAVKDAINEAFERPLSAGMRYERDAF 231
5 -90.800d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  28  1.ADIDFRIEGHVAHVRLNRPQGLNAITQEMDDLLLDAWTEVNANSDIWAVVLSAEGKAFCIGADVSGGAERKTRMALGGGLTGIGGPLVTCKKPMVAAVQGFCVGGGFELAMCADIIVAADTAQFGLPETKVGIIGECGVVHRAMRQLPYHIALQLILTGERIKADEARHYGLVNEVVPFAELEEAALRWASKLNAASPLAVQAAKAAALGRLGHPLEVALMTRFEPI 228
6 -90.600d4f47a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  34  1GPDALVEQRGHTLIVTMNRPSRRNALSGEMMQIMVEAWDRVDNDPDIRCCILTGAGGYFCAGMDLKAATKKPPGDSFKDGRIDALLKGRRLKKPLIAAVEGPAIAGGTEILQGTDIRVAAESAKFGISEAKWSLYPMGGSAVRLVRQIPYTVACDLLLTGRHITAAEAKEMGLVGHVVPDGQALTKALEIAEIIAANGPLAVQAILRTIRETEGMHENEAFKIDTRIG 233
7 -90.200d3swxa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 36809]}  ali model 3D-neighbors follow..  31  3.ETLRIRRDGYVLVIGLNRPAKRNAFDKTMLEELALALGEYETDTDLRAAVLYGEGPLFTAGLDLASVAAEIQGGASEGGINPWQVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQLEVNRGIYPFGGATIRFPRTAGWGNAMRWMLTADTFDAVEAHRIGIVQEIVPVGEHVDTAIAIAQTIARQAPLGVQATLRNARLAVREGDAAAEEQLVPTV 232
8 -89.700d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}  ali model 3D-neighbors follow..  26  1..DVLFSNHGRVAVITLNRPERLNAWTTPMRETIIDALERFNRDPEVAAIIMTGAGRAFSAGQDLSEAHDFDGERAVAKEWQRYYTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRMGQPEINAGI-ASTTGPWIMNAMLGMSRTIELTLTGRLMEAEECHRIGLIHHLVDEDKVFDKALEIATELAAKPPVAMRLDKQRFREMTEPGFIDCIEAGERI. 227
9 -88.600d5e0nx_ c.14.1.0 (X:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  30  3.FVLLDRSRPGVALVTLNRPERMNSMAFDVMVPLLELLGDLRHDNSVRVVILTGAGRGFSSGADHKSAGSVPHVDGSMEVLDNVILALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYFRAAGINNGLTASEGLSYLLPRAIGTSRAFEIMLTGRDVDAAEAERIGLVSRTVPDDDLLETCFEMAQRMRGFSRPGIELTKRTLWSGLDASLEGHMQAE.... 236
10 -88.600d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  21  2...VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGARSFSAGGDFNEVKQLSRSEDIEDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKRAVNKPFIHLLEQTRDASKAVH 229
11 -88.300d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  33  2.PEFKVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGKAFCAGADLKERATMAEDEVFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKY 231
12 -88.100d3peaa_ c.14.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}  ali model 3D-neighbors follow..  25  3.KFLSVRVEDHIAVATLNHAPA-NAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFSAGADIKEFTSVTEAKELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIF 231
13 -87.300d3gowa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  32  2...VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDRKPDEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQ 227
14 -87.100d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}  ali model 3D-neighbors follow..  25  2.DTLDFEVVNNVGWIRMNRAAKHNPFDAELRADLMTVLERVRDDADIRVLVLTSHPGSFCAGGNLHVLRDNLDSQQRIKTGLRFIHDMLNLGRPVIAAVDGPAFGAGFALSLTADIVLASPRARFSMAYLRLGLVPDLGALYLLPRAVGLQRAKELMFSTRELDAEEAHRLGLVMEVHESEALEQRAREIAESLVQAAPTALALTKAALNVSLDSDEQTMFSLEAASQ 233
15 -87.100d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  23  5.AGLDVTLSDGVFSVTINRPDSLNSLTVPVITGIADAMEYAATDPEVKVVRIGGAGRGFSSGAGISADDVSDGGDEIILEINRLVRAIAALPHPVVAVVQGPAAGVGVSIALACDVVLASENAFFMLAFTKIGLMPDGGASALVAAAVGRIRAMQMALLPERLPAAEALAWGLVTAVYPADEFEAEVDKVIARLLSGPAVAFAKTKLAINAATLTELDPALQREFDGQ 235
16 -86.800d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  24  2..AIKSTSEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENNPEIRSVVITGEGAVFCAGGNLQRLQANRREAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMSYSTVGLSPDGGGSWSLARSLPRALASELLMGGERISAQRLHDLGLVNKVASAGDALSEALRMAGQLNARAPNALASIKELINEASSNTLSQQLACERDHF 232
17 -86.600d3rrva_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  25  4PTEIDVRADGALRIITLNRPDSLNSVNDDLHVGLARLWQRLTDDPTARAAVITGAGRAFSAGGDFGYLKELSADADLRRDGREIVLGMARCRIPVVAAVNGPAVGLGCSLVALSDIVYIAENAYLADPHVQVGLVAADGGPLTWPLHISLLLAKEYALTGTRISAQRAVELGLANHVAD--DPVAEAIACAKKILELPQQAVESTKRVLNIHLERAVLASLDYALSAE 233
18 -86.400d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  26  5TGRISVAIADGVASVEISNLAQRNALTKDMCLEIQELMPQLDADPDVAVVVLRGAGDTFCAGASISELADPQPDGSTADHLSRADSAIAALSKPAVALVDGACMGGGWQIASACDFIIANERAVIGLTPAKIGIIYPRPGLERLVRLVGHANAKYILLTGQTFSAPEARALGLVADVVPSESFEEKCAALVRSLRSRSRFSMHSMKRLVDLTDSVPAAGIDQEWAAAW 236
19 -86.200d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}  ali model 3D-neighbors follow..  25  3.EAIGHRVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIPLDKGVAIAALWWHQMIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCAWHTIGIGNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKERFHAGWMQPVEECTEFEIQNV 236
20 -86.100d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  30  3...VEIERRGDASLIVLSRPEKLNAINLEMLADLADQFSKAEKE-DTRVIVITGYGKNFSAGADINMLASFDPASAFRLKMNSIAQRIRKSDKPVIALLKGYSMGGGLELAESADIRIAMSDAVIGQPESSIGINAGAGGNVILPKLVGRGSAAYLAMSGKKLNAQEAMALGLVDEVVDDEA---KAWKIIDDICKKPKKTLQFIKRAINSSYDMGLESAMDQEALYF 225
21 -86.000d3qxza1 c.14.1.0 (A:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}  ali model 3D-neighbors follow..  30  1.TELHEEIRDGVAVLTLHGPSTRNSFTVELGRQLGAAYQRLDDDPAVRVIVLTGAPPAFCSGAQISAAAETAAPRNPDFSASPVQPAAFELRTPVIAAVNGHAIGIGMTLALHADIRILAEEGRYAIPQVRFGVAPDALAHWTLPRLVGTAVAAELLLTGASFSAQRAVETGLANRCLPAGKVLGAALRMAHDIATNAPESAALTKRLLWDAQMTGMSAAEVAARET. 228
22 -86.000d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  29  1SELVLSHVEGGVQVVRMNRPDKKNALIGEMYAALAEAFAKGEADDDVNVFLILGSQTDFSAGNDLPDFLTWEALS--GSVADRFIRAVAGARKPVVAAVRGAAIGIGSTLLPHCDLVYAAPGTRFHMPFINLGIVPEAGSSQTMPALAGHRRAAEMLMLGEPFGVDTAEAVGLINGVVPGEDLEETAMAAARKLAAKPRSILVQIKALMKTPAE-PIMDRLTREAAVF 225
23 -85.700d3tlfa_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  25  4.DTIKYEVDGHTATITLNRPDALNALSPHMITELRAAYHEAENDDRVWLLVVTGTGRAFCSGADVKEIPEDGKVIYEREAPQEGTPPFRTMAKPVLTAVNGICCGAGMDWVTTTDIVIASEQATFFDPHVSIGLVAG-RELVRVSRVLPRSIALRMALMGERMSAQRAYELGLISEIVEHDRLLERAHEIADIVNSNAPLAVRGTRLAILKGLNVPLHEAEILAETFR 240
24 -84.600d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  23  8.DRVSVTIEDHVAHVLLDRADKMNALDDAMFEGIVAAGHHLHSVKGVRCVVLSGAGRSFCAGLDLSSMGRTDRWSGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVMEVKWGLVPDMAGYALWRGNVRDDVLRELTYTHREFSGEEAVRFGFATHVAD--DPLAGAMELARVVAEKSPNAVRGAKTLSNRAPDLTVDDVLMAESIAQ 241
25 -84.500d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  29  7.SNLDLDRDNGVCVVTLNRPDKRNALDVATIEELVTFFSTAH-RKGVRAVVLTGAGDHFCAGLDLVEHWKADRSADVCLRWHEAFNKMEYGGVPIIAALRGAVVGGGLELASAAHLRVMDQSTYFALPEGQRGIFTGGGATIRVSDMIGKYRMIDMILTGRVYQGQEAADLGLAQYITE-GSSFDKAMELADKIASNLPLTNFAICSAISHMQNMSGLDAAYAEAFVG 236
26 -84.400d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  4.QYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGKVFSAGHDIHELPSGGRDPSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERIQ. 231
27 -84.400d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  29  2SDVIQLVREGAIATVTLNRPDRMNALNLPMWRGLAEAFETISADRSIHVVILRGAGKAFAPGADIEEFDTAEQAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGLELACCCDIRLSAKSGKFGVPINKISVVMAYPELAQIRRVAGPAAALEILLEGRIMDADEAAAKRLVNRVVEDDAMDAEVAATAKRIAAGAPLANRWHKAFIARLDDPTPVSEAELDE... 231
28 -84.000d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  28  2.PHLNANLEGGVLTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEHDFTAGNDMKDFMGPNAGPAGQVPPFVLLKSAARLSKPLIIAVKGVAIGIGVTILLQADLVFADNTALFQIPFVSLGLSPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVE--DAYATAQATAQHLTALPLASLKQTKALMKHDLD-QIIECIDHEAEIF 229
29 -83.600d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  30  1TLPIRLDIAAPLAEIVLNKPERRNALSVDMWAAIPGLVAEANANPDVKLILIHGGDGAFAAGADISEFETEDAAKASGQRIAQALDAIENSEKPVIAAIEGACVGGGVSLAMAADLRVAGEGAKFGVTPGKLGLVYPAGDTRRLLAAVGPGATKDILFTGRIFTAGEAKSLGLIDRLVEKGTALEAARVWAGEIAAISQWSVRATKRMI-RGLQTGWTDETPEAQSLF 232
30 -83.500d3myba_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  26  5...LQDRDERGVVTLTLNRPQAFNALSEAMLAALGEAFGTLAEDESVRAVVLAASGKAFCAGHDLKEMRAEPSREYYEKRCTDVMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVSGINVGLFCSTPGVA-LSRNVGRKAAFEMLVTGEFVSADDAKGLGLVNRVVAPKALDDEIEAMVSKIVAKPRAAVAMGKALFYRQIETDIESAYADAGTTM 231
31 -83.300d2q35a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}  ali model 3D-neighbors follow..  20  3...QLTELGNGVVQITMKDESSRNGFSPSIVEGLRHCFSVVAQNQQYKVVILTGYGNYFSSGASKEFLIRKTRGEV---EVLDLSGLILDCEIPIIAAMQGHSFGGGLLLGLYADFVVFSQESVYATNFMKYGFTPVGATSLILREKLGSELAQEMIYTGENYRGKELAERGIPFPVVSRQDVLNYAQQLGQKIAKSPRLSLVALKQHLSADIKAKFPEAIKKELEIH 224
32 -83.000d2ppya_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}  ali model 3D-neighbors follow..  26  8.QYLTVFKEDGIAEIHLHINK-SNSYDLEFYKEFNAAIDDIRFDPDIKVVIVMSDVKFFSAGADINFLRSADPRFKFCLFCNETLDKIARSPQVYIACLEGHTVGGGLEMALACDLRFMGDEAKIGLPEVSLGVLAGTGGTQRLARLIGYSRALDMNITGETITPQEALEIGLVNRVFPQAETRERTREYARKLANSATYAVSNIKLAIMNGKEMPLNVAIRYEGELQ 237
33 -82.000d4k29a_ c.14.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  26  3.SKILYETLHGVARITLNRPERTNALDQEMLGEINAAMDAAEADAGVKAVIVRGAGNAFSSGFDLKAQMEARPAGVLLRKDFDTVMRFWHCPKPTIAAVRGPCLAGACELALACDMTIATEDAFFGEPELKFG---AGIVVMLLPWIVGPKIAKEIILLGERVPARRAAEIGMVNRVVDGDGLDAEALRIARHIGAIDPGLVKETKRALNRALETQLESALEIDLAI. 236
34 -81.900d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  3.ETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIIT-VLTGNGDYYSSGNDLTNFTDEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVL 234
35 -81.000d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  30  2...IGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAG-DGSARAIVLTGQGTAFCAGADLSGDAF---AADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLAD----AQAWAAEIARLAPLAIQHAKRVLNDD--GAIEEAWPAHKELF 216
36 -80.700d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  20  1.SDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGKHFSAGADLTWMQSMANFTEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLGLIPA-VISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLEFTLKYASQISNNAPEAVKNSKQLAQYVANKKIDEEL....... 224
37 -80.300d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  28  6...QVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFPDDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWN 245
38 -80.200d4qiia_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  21  23.ITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGWAFCSGGDQRIRGRSGYQRAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASEYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLL-DDGLVGQQLFAGEAT 269
39 -80.200d4k3wa_ c.14.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}  ali model 3D-neighbors follow..  26  2.ETLILEKQGPTLVITINRPDVRNAMSLQMVAELSTIFSEIENDISIRAAVLRGAGGHFCAGGDIKDMAGARSQKALNRAFGQMIQQVNESSKVVIAITEGAVMGGGFGLACVSDLAIAGPTAKFGMPETTLGVIPAQIAPFVVER-IGLTQARRLALLGLRIDATEACKLGIVHQVAESEEQLSDMLQALERVRLCAPDATAETKALLHRVGHEAMAGLLDDAAEKF 238
40 -80.200d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  22  12...AFAWPRPGVLEITF-RGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGVFSAGGSFGLIEEMRASHEVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKHALNHWYRSFL-PHFELSLALE 238
41 -79.900d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  26  2..SLRLERDGAVARLLIDRADRRNAFSLDMWQRLPELLAEASGDDALRVLVVKSANGAFCAGADIAELLANKDDAANQQAINRAQYELARFRLPTVAMVEGDCIGGGCGIALACDMRIAAPAARFGITPAKLGLVYPLHDVKLLVDLVGPGQARRLMFTGGLIDANEAHRIGLVELLGESEDA------LVGQLATVSSFSTQAIKSFVRRVLDGQVADDADSLR... 223
42 -79.800d3oc7a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}  ali model 3D-neighbors follow..  25  7.YAGPAATGGPVARLTLNSPHNRNALSTALVSQLHQGLRDASSDPAVRVVVLAHTGGTFCAGADLSEAGSGGSPSERAREMAALMRAIVESRLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSFALTEARIGVAPAIISLTLLPK-LSARAAARYYLTGEKFDARRAEEIGLITMAAE--DLDAAIDQLVTDVGRGSPQGLAASKALTTAAVLERFDRDAERLAEES 237
43 -79.800d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  3.RDIVVRKQDGFTHILLSKSSENNSLNPEVMREVQSALSTAAAD-DSKLVLLSAVGSVFCCGLDFIYFIRRLTDDKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANERECEVL 235
44 -79.500d2j5ga_ c.14.1.0 (A:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}  ali model 3D-neighbors follow..  21  9.ENLHFHRENGILEVRMHTNGSSLVFTGKTHREFPDAFYDISRDRDNRVVILTGSGDAWMAEIDFPSLGDVTNPREWDKEGKKVLQNLLDIEVPVISAVNGAALLHS-EYILTTDIILASENTVFDMPHLNAGIVPGDGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVALTQRLKRLVNEGIGYGLALE 239
45 -78.200d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  26  11RPLSQDGTTQGGTVATLTLAAKMGSMGPAFWQEFPQAL---SELGDARVLIVRGE-QVFSAGLDVKSNGKPDAFKAVVDEMHAVTEGLAALPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLPEVKLGITADLGGLQRLPHLIGRGRTAHLALTGEAIDAATAERWGLVTEVLPDDALFARAEALAEHLAALPAKALEGTKRALSDG--LPHAESLAAAVRWN 241
46 -77.100d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  20  4.VLVEPDAGAGVAVMKFKNPPV-NSLSLEFLTELVISLEKLENDKSFRGVILTSDRGVFSAGLDLTEMCGRSPAHYAGKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNF 234
47 -77.000d3h0ua1 c.14.1.0 (A:8-283) automated matches {Streptomyces avermitilis [TaxId: 33903]}  ali model 3D-neighbors follow..  23  5.ETIKARLDGTVLSATFNAPP-MNLIGPEVVRDLVALLEELAHPTAPRVVIFDSADDFFFPHVDMTKVPEYTAEAAKAASLGMLFRKLSQLPAVTIAKLRGRARGAGSEFLLACDMRFASENAILGQPEVGIGAPPGAGAIQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKSAIN-AISLPAPAEVRADAALF 236
48 -76.500d1hnua_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  16  1NEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKAQGDDTFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSNDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNES 248
49 -75.500d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  18  3.QTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCE-TSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGSSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPA-CVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVL--LRKHLLRLRRLNKKGIAHYKQFM-SSLDHQVSRAKATALTAN 228
50 -66.600d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}  ali model 3D-neighbors follow..  25  12......ALESGIVELKFDLKESVNKFNRLTLNELRQAVDAIKADASVKGVIVSSGKDVFIVGADITEFVENFKLPDAELEANKIFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDLIKRAISGELDAPVEAIKTIQKAANFGRDKALEVEAAGF 278
51 -11.500d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  13  100......RVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCS-----GVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAV-----------GGAGILSGMNPKGYIDDEA-ENSKLKVPAYDETGFFREVYQNDL---GVIDGIKKYISYLP............................. 288
52 -10.800d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  16  85......TILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSG-----GARIQE----GIDSLSGYGKMFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFI-----------TGPQVIKSVTGEDVTADEL------AEAHMAISGNIHFVAEDDD---AAELIAKKLLSFLP............................. 250
53 -10.300d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  97..........PVVAAAFEFAFMGGSMGSVVGARFVRAV-EQALEDNCPLICFSASG-----GARMQE---ALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSSFAMLGDLNIAEPKALIGF-----------AGPRVIEQTVREKLPPGF-------RSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPA............................. 260
54 -10.000d3p2ta1 b.1.1.0 (A:2-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  2..........................................................................................LPKPTLWAEPGSVISWGNSVTIWCNPLEPKNKARFSIPSMT----EDYAGRYRCYYRSPVSDPLELVMTG.................................................................... 95

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.