current user: public
If you have questions about the server, please let us know.

Query: d4uzwa1 a.140.2.1 (A:2-50) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst ADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSPQLast
1 -30.400d4uzwa1 a.140.2.1 (A:2-50) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors  100  1ADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSPQ 49
2 -22.000d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  13GTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD.......... 51
3 -21.600d1zrja1 a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucleoprotein U-like protein 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  40  2.DVRRLKVNELREELQRRGLDTRGLKAELAERLQAA............. 36
4 -16.400d1v66a_ a.140.2.1 (A:) p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  11..VMSLRVSELQVLLGYAGRNKHGRKHELLTKALH.............. 43
5 -11.000d1y02a1 a.140.2.1 (A:71-114) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  4EELMKMKVKDLRDYLSLHDISTEMEKEELVLLVLGQ............. 41
6 -10.000d1kcfa1 a.140.2.1 (A:3-38) Mitochondrial resolvase ydc2 N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}  ali model 3D-neighbors follow..  25  1....TVKLSFLQHICKLTGLSRSGRKDELLRRIVDS............. 32
7 -8.390d1h9ea_ a.140.1.1 (A:) Thymopoietin, LAP2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  6.DPSVLTKDKLKSELVANNVTLEQRKDVYVQLYLQH............. 43
8 -6.830d1a62a1 a.140.3.1 (A:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  4TELKNTPVSELITLGENMGLENLARKQDIIFAILKQHAKS......... 45
9 -5.710d2outa1 a.140.3.2 (A:94-131) Uncharacterized protein HI1507 in Mu-like prophage FluMu region {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  33  1.......VEQLKAQLTERGIKQSATKAELIALFAPADGEKSEA...... 38
10 -5.380d1h9fa_ a.140.1.1 (A:) Thymopoietin, LAP2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  8LDVTELTNEDLLDQLVKYGVNVGTTRKLYEKKLLKLREQGTESRSS... 57
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.