current user: public

If you have questions about the server, please let us know.

Query: d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst ILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGLast
1 -111.000d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1ILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAG 234
2 -101.000d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  38  7.SGEKRLIPKPTCRFKDAQQYPDLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPI--SREQRNGPGMLVLTPTRELALHVEAECSKYSY-------KGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYV.... 227
3 -101.000d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  36  1VEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRRKQYPISLVLAPTRELAVQIYEEARKFSY------RSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVG... 239
4 -86.700d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  11IHVQGTDLPDPIATFQQLKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPA-------NKGFRALIISPTRELASQIHRELIKISEGTG------FRIHMIHKAAVAAKKFGKSSKKFDILVTTPNRLIYLLKQDPIDLASVEWLVVDESDKLFETGFRDQLASIFLACTSHVRRAMFSATFAYDVEQWCKLNLDNVISVSIGA.. 240
5 -82.500d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  37  2.............EFKDFPLKPEILEALHGRGLTTPTPIEAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLAPSQ-----ERGRKPRALVLTPTRELALQVASELTAVAP--------HLKVVAVYGGTGYGKQKEALLRGADAVVATPGRALDYLRQGVLDLSRVEVAVLDEADEMLSMGFEEEVEALLSATPPSRQTLLFSATLPSWAKRLAERYMKNPVLINVIK.. 207
6 -81.900d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  37  10........EEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETP--------QRLFALVLTPTRELAFQISEQFEALGSSIG------VQSAVIVGGIDSMSQSLALAKKPHIIIATPGRLIDHLENKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSS.. 220
7 -81.000d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  29  1............TQFTRFPFQPFIIEAIKTLRFYKPTEIQERIIPGALRGESMVGQSQTGTGKTHAYLLPIMEKIKPERAE--------VQAVITAPTRELATQIYHETLKITKFCPK--DRMIVARCLIGGTDKQKALEKLNVQPHIVIGTPGRINDFIREQALDVHTAHILVVDEADLMLDMGFITDVDQIAARMPKDLQMLVFSATIPEKLKPFLKKYMENPTFVHV.... 208
8 -80.100d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  2............NEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKK--------DNIQAMVIVPTRELALQVSQICIQVSKHM-----GGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL.... 206
9 -77.200d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  32  1...................MNEKIEQAIREMGFKNFTEVQSKTIPLMLQGKNVVVRAKTGSGKTAAYAIPIL--------------ELGMKSLVVTPTRELTRQVASHIRDIGRYMD------TKVAEVYGGMPYKAQINRV-RNADIVVATPGRLLDLWSKGVIDLSSFEIVIIDEADLMFEMGFIDDIKIILAQTSNRKITGLFSATIPEEIRKVVKDFITNYEEIEAC... 191
10 -76.700d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  35  19........VNEITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQW----TSTDGLGVLIISPTRELAYQTFEVLRKVGKNHD------FSAGLIIGGKDLKHEAERI-NNINILVCTPGRLLQHMDETVFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYVWVHE.. 232
11 -76.300d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  30  3.....TNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKA--------PQALMLAPTRELALQIQKVVMALAFHMD------IKVHACIGGTSFVEDAEGL-RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV.... 212
12 -75.700d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  1............SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQ--------VSVLVMCHTRELAFQISKEYERFSKYM-----PNVKVAVFFGGLSIKKDEEVLKKNCHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLELDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV.... 207
13 -73.900d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  1............ADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLV--------LENLSTQILILAPTREIAVQIHSVITAIGIKM-----EGLECHVFIGGTPLSQDKTRLK-KCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRL.... 205
14 -68.600d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  28  1...........AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNRNMIAQSQSGTGKTAAFSLTMLTRVNPEDAS--------PQAICLAPSRELARQTLEVVQEMGKFTKI-----TSQLIVPDSFEKNKQI-----NAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIV............ 196
15 -57.000d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  2AAAAAAAAAAALCLFPEDFLLKEFVE-FFRKCVGEPRAIQKMWAKRILRKESFAATAPTGVGKTSFGLAMSLFLAL-----------KGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENLI--GYYHGRIPKREKENFMQRNFKIVITTTQFLSKHYR----ELGHFDFIFVDDVDAILKLGFHYDLKTKSWVGEARGCLMVSTATAKKGKKAELFRQL---LNFDIGSSR 230
16 -25.500d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  18  9..................SISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGK-----------SLYVVPLRALAGEKYESFKKWEKI-------GLRIGISTGDYESRDEH----GDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMRKALRVIGLSATAP-NVTEIAE............... 190
17 -21.400d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  1...........MAQAEVLNLESGAKQVLQETGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLL----------------LTVVVSPLISLMKDQVDQLQANG----------VAAACLNSTQTREQQLEVMTGQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGFRPEYAALLRQRFPTLPFMALTATADDTTRQDIVRLL............ 196
18 -20.700d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  17  9..................................QPRIYQEVIYAKCKETNCLI-VLPTGLGKTLIAMMIAEYRLTKYGGK----------VLMLAPTKPLVLQHAESFRRLFNL-------PPEKIVALTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRISLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTAS-PEKIMEVINNLGIEHIEY...... 187
19 -19.100d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  17  113..................................EPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLARYYLENYEGK----------ILIIVPTTALTTQMADDFVDYR------LFSHAMIKKIGGGASKDDKYKNDA---PVVVGTWQTVVKQPKE----FSQFGMMMNDECHLA-----GKSISSIISGLNNCMFKFGLSGSLRDGKANIMQ------YVGMFGEI. 279
20 -16.800d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  13  1.............................................MLKKGMTTVLDFHPGAGKTRRFLPQILAECARR----------RLRTLVLAPTRVVLSEMKEAFHGLD------------------KFHTQAFSAHGSGREVIDAMCHATLTYRMLEP-TRVVNWEVIIMDEAHFLDPASIAARGWAAHRARANESATILMTATPP....................... 138
21 -14.400d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  19  3............................................AVPQSFQVAHLHAPTGSGKSTK--VPAAYA------------AQGYKVLVLNPSVAATLGF---GAYMSKAHGVDPNIRTGVRTITTGSP-------------ITYSTYGKF---LADGGCSGGAYDIIICDECSTDATSILGIGTVLDQAETAGARLVVLATAT......................... 135
22 -13.800d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  20  70..................................SLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAI--------------NELSTPTLIVVPTLALAEQWKERLGIFG------------------EEYVGEFSGRIKELKPLTVST---YDSAYVNAEKLGNRFMLLIFDEVHHL-----AESYVQIAQMSIA-PFRLGLTAT......................... 204
23 -12.400d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  23  111........................................................GDVGSGKTVVAQLAILDNYEA-----------GFQTAFMVPTSILAIQHYRRTVESFSKFN------IHVALLIGATTPSEKKSGLRNGIDVVIGTHALIQE-----DVHFKNLGLVIIDEQHR-----FGVKQREALMNKGKMVDTLVMSATIPRSM.................... 246
24 -11.800d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  18  82.........................KYVDILKIRRELPVRDEFLKLYQNNQIMVFVGETGSGKTTQ--IPQFVLFDE------MPHLENTQVACTQPRRVAAMSVQRVAEEMDVKLGEEVGYSIR--------------NKTSNKTILKYMTDGMLLREAMEDH-DLSRYSCIILDEAERTLATDILMGLLKQVVKRRPDLKIIIMSATL--DAEKFQRYFNDAPLLAVPGR.. 270
25 -11.100d4q7ka_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}  ali model 3D-neighbors follow..  13  4..............................................VKPGSLVAVLGETGSGKST--LMNLIPRLIDPERGRVEVDELDVRTVKLKDLRGHISAVPQETVLFSGTIGREDATDDEIVEAAKIAQIHDFIISLPEGYDSRVERGGRNFSGGQKQRLSIARAKVLILDDCTSSVDPITEKRILDGLKRYTKGCTTFIITQKIPTALLADKILVLHEGKVAGFGT.. 198
26 -11.000d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}  ali model 3D-neighbors follow..  10  10...............................AYDDSEQILRDISFEAQPNSIIAFAGPSGGGKST--IFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGK.. 220
27 -10.600d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  55..................................ETTPDQAQAINAVLSDMDRLVCGDVGFGKTEVAMRAAFLAVD-----------NHKQVAVLVPTTLLAQQHYDN---FRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGIDILIGT-----HKLLQSDVKFKDLGLLIVDEEHR-----FGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIAT.... 233
28 -10.600d2ff7a2 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  26..............................................IKQGEVIGIVGRSGSGKST--LTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARAKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGK.. 220
29 -10.400d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  7............................................................................................VRVDLPEIYKEVRKLLREMLRDALK-----PLAETGLLESSSPDIPKKEVLRAGQIINEEMAKGNHDLRGLLLYHAMA--LKLHHAIELLETQGLSALRAYIKKLYEEAKAGSTKAS---------KEIFSDKRMKKA.... 128
30 -10.400d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  16  4............................................PSMLKKKQLTVLLHPGAGKTRRVLPEIVREAIKKRLRT----------VILAPTRVVAAEMEEALRGLPVRYMTTAVN-----------------VTHSGTEIVDLMCHATFTSRLLQPI-RVPNYNLNIMDEASSIAARGYISTRVE-----MGEAAAIFMTATPPGTRDAFPDS.............. 152
31 -10.300d5x7ka_ c.37.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}  ali model 3D-neighbors follow..  14  35..............................................IQPGDVLGIIGPSASGKST--LARLLVGIWPVSEGIVRLDNADIYQWNKDELGPYIGYLPQDIELFAGTIAENDIDSEKVIEAAKLAGVHELILRFPNGYDSVIGNGGAGLSGGQKQRIGLARALYVVLDEPNSNLDDAGEKALNQAIMFLKQRNKTVVLITHRTNLLSMTSKLLLLVNGNV...... 224
32 -9.140d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  153.......................................QKVAAAVALTRRISVISGGPGTGKTVAKLLAALIQMADGERCR---------IRLAAPTGKAAARLTESLGKALRQLPLT--------------------DEQKKRIPEDASTLHRLLGALRHHAGNPLHLDVLVVDEAS-MIDLPM---MSRLIDALPDHARVIFLG-----DRDQLAS--------VEAGAV. 308

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.