current user: public
If you have questions about the server, please let us know.

Query: d5u1ma_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst KEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDAFRLast
1 -72.300d5u1ma_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1KEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDAFR 105
2 -56.500d2v76a_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  3GSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIH.......... 101
3 -52.900d1j0wa1 b.55.1.2 (A:9-106) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  2SERFNVYLMP---SPNLDVHGECALQITYEYICLWDVQNPRKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAE...... 98
4 -49.300d1xr0b1 b.55.1.2 (B:11-136) FGFR substrate 2 (SNT-1) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  8RNKFKVINVDD----DGNELGSGIMELTDTELILYT--RKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEP 106
5 -24.100d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  18  4..FFLV----KEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQ---DGYYSVQTTEGEQIAQLIAGYIDII........ 91
6 -9.930d2cy4a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  16  45.....................EMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCGRSRSLLLLVCQEPERAQPDVHFFQGLLLGA-----ELIREDIQGALQNYR 129
7 -8.920d3dxea_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  6  17VDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLARDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDAR 123
8 -8.880d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  1.EMYGVNYFAIRNKKGTEL----LLGVDALGLHIYDPENRTPKISFPWNEIRNISYSDKEFTIKP----DKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK 98
9 -7.850d2m38a_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  9  31DACAKMRANCQKSTEQMKKVPTIILSVSAKGVKFIDATNKNIIAEHEIRNISCAAQDPETFAYITKDLKSNHHYCHVFTAFDVNLAAEIILTLGQAFEVAYQ... 135
10 -7.620d2he7a3 b.55.1.0 (A:297-390) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  8  14.....................EIMLGVCASGLLIYRDRLRINRFAWP--KVLKISYKRNNFYIKI-GEFEQFESTIGFKLPNHRAAKRLWKVCVE.......... 86
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 8 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Jaroszewski L, Li W, Godzik A. Comparison of sequence profiles. Strategies for structural predictions using sequence information. Protein Sci. 2000 Feb;9(2):232-41.