current user: public

If you have questions about the server, please let us know.

Query: d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst AFTACEKQTIGKIAQVLAKSPEAYGAECLARLFVTHPGSKSYFEYKDYSAAGAKVQVHGGKVIRAVVKAAEHVDDLHSHLETLALTHGKKLLVDPQNFPMLSECIIVTLATHLTEFSPDTHCAVDKLLSAICQELSSRYRLast
1 -46.900[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  16  2.LDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQREAL--FNAIAAYASNIENLPALLPAVEKIAQKHT-SFQIKPEQYNIVGTHLLATLDEMFN-PGQEVLDAWGKAYGVLANVFIHREA 136
2 -25.400[C] KOG3378 Globins and related hemoproteins  ali follow..  16  258RITERQKHIFTETFPVIFKEYKRNGLVLFAKYFSEFPHYKNIWPQFSALLASNELANHCSVYMSGLKV........................................................................ 330
3 -7.410[R] COG2346 Truncated hemoglobins  ali follow..  16..EATMSSETVTLYEAIDATVRALTRRFYELM-DTLPEAARCRAI-----HPADLSGSEAKFYDYLTGYLGGPPVYVEK-PMLRRRHF-VAPIGPAERDEWLLCFRRAMDET--IENAKLREIIWAPVERLAFHMQNQ.. 146
4 -5.770[I] KOG3006 Transthyretin and related proteins  ali follow..  24.STSGPLTSQEAIYTARDIWFNQVNVTDWLEAFSAHPQIGNTPSPSINSDFARRSVSEQSTAFATTS------ASALQELAEWNVLYKKKFG-----FIFIHAEMLHALKERYEN-IVELEIAAMEQMKITELRMAK... 156
5 -5.560[C] KOG4516 NADH:ubiquinone oxidoreductase, NDUFC2/B14.5B subunit  ali follow..  11  30....DPFTWSYPLKGASAMLGISLASVYLQNRWNKKPYYYAIVPRL------------LIGAATAAGYAAGALRE-DAVIEHYMKLH-------PEDFDHFNDRSGRSFSQVLLPWYP-RRTQYTRY............. 138
6 -5.310[TR] KOG2224 Uncharacterized conserved protein, contains TBC domain  ali follow..  526NPNSEIMKNILLNYAVMYPDINYI-SDLLAPLLSTLKDEVDSYFCFKNFMQQTVFSSTPQGNENLMETNLTYLRNMLRMFVPDFYEHLEKQRPDAMQLMFVHRWILLCFKREFP---NYALHIWECCWAFVCVAIVSIYG 674
7 -5.120[A] COG5107 Pre-mRNA 3`-end processing (cleavage and polyadenylation) factor  ali follow..  43...........LSYFQLIQYLETQEREVYEQFHNTFPFYSPAWTLQLKGELARDEFETVEKILAQCLSGKLENNDLSLWSTYL--DYIRRKNNLITGGQEARAVIVKAFQLVMQKCAIFEPKSWNEYLNFLEQW...... 171
8 -5.060[R] KOG4567 GTPase-activating protein  ali follow..  14  226AYVQGMNEIVGPLYYTFATDAEADTFFCFTNLMA---EIRDNFIKSLDDSQC------------GITYKMEKVYSTLKDKDVELYLKLQEQNIKPQFFAF----LTLLLSQEFL---PDVIRIWDSLFALVCCAMLMLIR 363
9 -5.050[H] COG4063 Tetrahydromethanopterin S-methyltransferase, subunit A  ali follow..  34..SHIEDVPVEAGAAIAGPKTENLGIEKMIANLISNPNIRFLILCGSEVQGHIT----GQSIEALHQNGVDP-TGAIPYIENIPDEGIERFQKQLEIVNLIDVEDADAIKAKVKECIEKDPGAFEE.............. 161
10 -4.990[A] COG5181 U2 snRNP spliceosome subunit  ali follow..  10 1020.YRTPEMNVQNGVLKSLAFMFEYIGEQARDYVYAITPLLADALM-----DRDAVHRQTAASVIKHLSLGCVG---LNILWPNILEESPHVINAVREGIDGIRNCIMAYLVQGLFHPSRKVRNTYWTSYNSAYVQSADAM. 1164

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.