current user: public
If you have questions about the server, please let us know.

Query: d1kjqa1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst GPAASAVILPQLTSQNVTFDNVQNAVGADLQIRLFGKPEIDGSRRLGVALATAESVVDAIERAKHAAGQVKVQGLast
1 -31.800[F] COG0027 Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase)  ali follow..  36  319SPSASKAIVVEGKSTQVVFGQLAEVLAPHTNLRLFGKGEVDGHRRMGVILARDISVEKALEKARRAYDKLEIA. 392
2 -25.300[F] COG0026 Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)  ali follow..  13  311SDCVMTNLIGDDINDVPAW-----LSKKDCLVHLYGKTEARPGRKMGHVTELLHTGKA................ 363
3 -13.300[F] KOG2835 Phosphoribosylamidoimidazole-succinocarboxamide synthase  ali follow..  17  314TNAIMLNVLGDKHTKDKELETCERALAPGSSVYLYGK-ESRPNRKVGHINIIASSMAECEQRLNYITGRTDIPI 387
4 -5.990[R] COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase  ali follow..  26  330.......................................IEEGEPLLTVLASHNSMEAAENLASNICSRVKKE. 363
5 -5.900[E] COG1448 Aspartate/tyrosine/aromatic aminotransferase  ali follow..  8  213...AYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIR... 280
6 -5.760[S] COG4471 Uncharacterized protein conserved in bacteria  ali follow..  6  7............................GMVVYLHSLKQSKMLRKFGNVHYVSKRLKYVMDQIEKTMDKIA... 54
7 -5.420[R] COG1691 NCAIR mutase (PurE)-related proteins  ali follow..  16  3....LTDILKSVKEGKIDLESAEQQVRGFVSYSHIAKVDTHRKNRTGVVEAICKEPEDVVEIARVMVVK..... 72
8 -5.400[S] COG2306 Uncharacterized conserved protein  ali follow..  15  101.....................VDLISVCGEPVTVMDIDELAAATSAGLIT--ADDAERAIDATLNAVEGITRHG 151
9 -5.230[H] COG5598 Trimethylamine:corrinoid methyltransferase  ali follow..  16  318APAAIAGAVVQAVAEVLAGLVYVNAIKPGHPA-IFGTWPFVSDLRTGAMSGGSAEQAVLTAACAQMAQFYDL.. 388
10 -5.190[K] KOG2240 RNA polymerase II general transcription factor BTF3 and related proteins  ali follow..  17  4......................EKLAKLQAQVRIGGKGTARRKKKVVHRTATADD-----KKLQSSLKKLAVN. 49
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 6 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.